Thanks for the links you provided on this page. The Kazaa ones where exactly what I was looking for. I also have a DI-614+, but I don't use it for web access as it's rather a poor router. I have instead installed a DSL modem in one of our servers and share the connection through that. The set-up works quite well, although it does leave an over-qualified router twiddling its thumbs :)
Anoushka Shankar is really a great player of Sitar. I have heard her playing with her father on T.V.
Anyways, how are you doing?
whyrus said:
how did u manage to send sms to reliance...frm web???is there any website..whcih offer FREE service???dont tell me abt smscountry.com or other whihc have paid service..
rss junkie said:
It doesnt' surprise me that allheadlinenews.com would offersomething like this considering that they look like the're doing alot with rss.
Angel said:
I hope you can direct me..
My XP crashed.. BUT, the machine keeps on looping. It’s so fast, I know I have a BSOD, BUT it’s a flash and I can not stop it to se the error. Then it starts again and again. I tried the safe mode, last known good config, but it loops again and again. Can’t stop it unless I shut off the PC.
Any direction would be great. You see, I’m not sure the OS is doing this, What I mean, I installed a new driver for IDE controller (VIA) and noticed I started having problems.
I can get into the BIOS but since the unit will not boot into the OS, I can not get to the device manager.
I truly thank you in advance for any and all help/direction you can give me.
Mr. Angel Marrero
NY.
Sindeir casatolora said:
Yes there's a portal www.indiasms.com wherein u can send free sms to any GSM/CDMA or SMS enabled Landline Telephone Number in India.
The site is soft launched and may not be available for some times
Anugrah Saxena said:
infact net4india is also good and we can send sms on any gsm / cdma mobile phones. They provide one sms free after registration
indiasms.com does not work & funonphone.com is not fair. you need to send sms in a specific time period, otherwise your balance expires. they are cheats...dont use their site!!!
mamta said:
how to send sms from web to reliance mobile
James said:
How to send sms fromthe web to Reliance India Mobile in bangalore for free....
pradeep said:
I found some pictures of anoushka from very early life very interesting
Being an uncle is great. You know, i'm already an uncle for 10 kids already in the age of 24!!! And am expecting a new entry in the next month. How about that mate???
funonphone.com is a cheater who says sms free but after registration says you can buy recharge vouchers as well as smstoindia.com is also not a good service which allows only three free sms and then they charge for more sms and even those three sms which i sent has not received by the respective mobile users
kiran said:
www.smscountry.com is a waste site
Bgdibulls said:
Hi All
Well it is a good news for Rediffmail account Holders Free " 1 GB " Mail Space, fine some people says it is crazy but its nesscary to have Huge
E mail space just two days back i read even Hotmail and also Yahoo they are joining this War.
pras said:
Ecept krify sms i didnt see any reliable sms sending through web, all the site smscountry, smsindia or rediff are bull shit dont use them
but krify gives only limited service but yet reliable that too for free
jackson said:
How to send email from the web to Reliance India Mobile in Goa for free....
myla said:
hi bob,
i was surprised by your june 23 entry:) i never expect you will mention my birthday in your blog...
anyway thanks for the greetings...
do take care bobby the great:):):)
mai
/ ps. i read ur comments on my june 22 blog entry;);)/
anna said:
hi what network mobile is +91 135 .......? Is 135 a reliance mobile phone? my friend reside at Dehradhun, what cellular network are providing there? Do you have any knowledge what website for free sms for this network please let me know i need it badly
Gassali said:
FUNONPHONE.COM is cheat..they dont provide srvice as they offer...Dont waste ur time by visting and registering urself...WASTE!!!
sneha said:
how to send sms via computer to reliance mobile what is ths cell address we have to type
Shankar said:
Hello i am regular visitor of smstoindia.com the service is very good and fast i dont agree with the posting of Mr.Prashant bcoz i am a paid user the smss which i have sent including Reliance mobiles all have reached the destination if the sms did not reach means its simply the problem with the mobile number entered thats all ..
vishal said:
Hi !!
Can we send free SMS through PC on mobille or landline connection of AIRTEL Madhya pradesh?
If yes, can anyone please pass me the link.
Thanks
Jimmy George said:
See guys, funonphone.com is a very nice site but they have now limited to 5 msgs per day. so i dont say its not reliable. go register and enjoy the fun of sendin atleast 5 free sms msgs per day to your loved and dear ones.
Umesh Bhosale said:
How to send sms from the web to Reliance India Mobile in Maharashtra for free....
Use MTBlacklist from http://www.jayallen.org/comment_spam/
And here is my blacklist http://brajeshwar.com/mt-static/blacklist.txt
Import that, you will be protected from over 4,000 url fragments. I use to receive over 200+ blog spams recently and now it trickled to about 3-5 which I can manage after installing MTBlacklist.
Or Best switch to Movable Type 3.0 (that is what I am doing soon)
aj said:
i live in canada and figured out a way to send sms to reliance phones in patna is thru email address- for example it will be "916120000000@ri.irisme.net"
i have been doing it for alst 6 months and it works.but u have to save the whole address as a email address in ur sim memory.
if all of u guys succeed - send me a letter of thanks- raj
It's me Jo here. Hey - Suppose my URL is www.joplanet.com and I want to re-direct it to www.maisnam.com. Then how can we make it so that the URL in the address bar will stay www.joplanet.com through out the browsing, while the pages of www.maisnam.com shows up?
I have a reliance no: , and Id like to sms, to a US tmobile cell. Can anyone tell me the best way to do it.
renu said:
how can i send sms to reliance mobile
pullareddy said:
I'm using ralianceindiacall calling card its good.If u reduce the rate 10 cents/minute anywhere in india that will be excellent when compare to another cards in the market.
HDTV Receiver said:
I hate the mail in rebates from Best Buy. Thay have it on almost everything! It's such a pain to cut out the USP code and mail all the requested things
The last time I checked, it was
Members > Invite Members
and then you have the option to skip invitation and add directly.
And yes, the option is still there!
desi said:
Well guyz, I just called reliance for help and they told me that the only way they know how to send sms to Reliance, India from the USA/UK is this way-
The sender has to send the SMS in this format ie, 91+stdcodewithoutzero+reliancenumber@ri.irisme.net
for eg. 91443108923@ri.irisme.net.
I'm sure what raj says is correct.
Sampath said:
Hi guyz, well even i do faced problems with smstoindia, funonphone, indiasms and smschild.
My favourate is, www.Krifysms.com a decent service. Though they wont claim much blablas, of all the services Krify providing they are simply best. Its absolutely free service.
Sneha latha said:
Yes, i do agree with above posts. The only internet web site i felt cofortable is http://www.krifysms.com/ their services are limited. but very much reliable.
Preetham said:
Krify is the best site to send sms...i agree to this. but the problem is u cant send sms to RIM phones. Does anyone know who provides such service?
xdf said:
You can use the
91STDCode-without-0RelinancePhoneNumber@ri.irisme.net format to send the SMS to a Reliance phone..without issues. I do the same using a sprint phone. However while I cannot receive SMS from the RIM phone on Sprint..it does come through on ATT Wireless though...
Bobby Maisnam said:
Hi xdf,
I have a question.
Does this mean that emails to reliance phones (using the format 91+std+number@ri.irisme.net) can be sent only using a cell phone and not using a normal email account like yahoo or rediffmail?
I tried sending SMS from my email account (and not from my cell phone) using the format specified in the messages above. But the messages did not get through.
- Bobby
Sneha said:
Surprisingly, expecting it to be a part of reliance owned website, when i see the whois record of the domain "irisme.net" i found it belong to Iris Wireless, USA.
Can someone comment on this ?
xdf said:
Bobby,
You are right about the emails from a computer - the messages to RIM seem to be delivered *only* if they originate from a mobile phone using the 91...@ri.irisme.net format.
Does anyone here receive SMS from Reliance on their mobiles? If so what carrier? The only carrier in the US that I know of, so far, on which RIM SMS is successful is ATT...
On a tangent...the interesting things is Reliance advertises on their website that they can send the msgs to Sprint, but Sprint says that they do not have any such agreement. In fact, one of Reliance techie reps confirmed to my contact in India that a msg that was sent to my sprint phone from RIM was "delivered" to Sprint however, I did not receive it here.
I am planning on giving up on Sprint and switching to ATT so that I can receive SMS from my folks in India...
Sanjay Kumar said:
Sending sms using +91+countrycodewithoutzero+mobileno@ri.irisme.net does not work thru email.It works only if u send sms from mobile using this as email id.
No site except www.krify.com is good for sending sms, but the disadvantage of krify is that it does not support Reliance Network(CDMA). Its good only for GSM Networks.
Does anyone here know abt a sms gateway thru which we can write a program to send sms ??
Rajesh said:
funonphone.com is the most horrible site. infact the only person who gives good feedback about the site is its owner nikhil ;-) smart..isnt it?
i think smscountry is comparatively better than the rest of the sites in the same league.
Nikhil M. said:
Hi. I'm a ATT wireless customer and I receive SMS from Reliance phones in India.
I use my ATT phone to send SMS to frnds in India who have a reliance phone. but since yesterday (Aug 11th) I'm facing problems sending SMS to them. I get a notification that the message could not be delivered to the reliance email address 91+citycode+mobileno@ri.irisme.net.
Is anyone else experiencing the same problem?
Thank you.
raj said:
hey sneha ,nikhil,rajesh,sanjay,xdf.- all you need to do is go to these companies websites and u can send free sms to the phones in us/canada/
for example if u go to sprint.com- u can click on link send sms and enter phone number, and ur done.
but if u guys donot have computer or web access, use email address like "irisme.net" from ur cell phone and though technically its not sms its email, but it reaches becos att/sprint are using cdma technology like reliance.
for example- for att in us its "areacode+number@attnet.com"
for sprint its "no+areacode@sprint.com"
about snehas question of "iris", they are service provider who offer it to anyone who wishes to use it. they are "info satellites" available for use commercially.
lemme know if u guys need any help from canada/usa.
relianceindiacall calling is the worst card i have ever used...Bad connection ....and if its connected quality is very low....can't hear anything.....
Ajay Kayal said:
Myself and my wife have been using relianceindiacall post-paid for the past 2 months and we are really satisfied with the call quality and connection. It is the best service I have ever had.
Bobby said:
Hi beaula,
Me and a couple of my friends have been using RelianceIndiaCall for almost 2 months now and the call quality has always been excellent. I have stopped buying other calling cards all together.
- Bobby
anant said:
gyz ,, www.happytexting.com was xcellent site for sending sms ..but now it's not workin ..ne1 knows ,why? can v send sms to RIM thru it?
v.krishnan said:
I really like this , it is the BEST on the market.
Hmz said:
Hey guys .. cool.. i believe u all r frm US or Canda n u has CDMA phone over ther.. m frm Dubai n v got only GSM here.. once b4 2 months i recievd a msg frm a friend's reliance phone but i couldnt send reply 2 him.. it got failed.. now he s also not able 2 send me msgs ..ok.. so can anyone help me how 2 ve a sms or email contact wit reliance phones..
hey guys go to www.adheeth.com/sms.php and send sms it really works...
bye
loves manish
Kaushik Sarkar said:
I live in india, kolkata. I cant send any sms through web to any RIM nos. refer me a site to send sms to any reliance nos. All the websites in this pages are of same backgrouds or even some of them are bullshits.
Try smsac.com to snd sms to indian nos for free.
but cant support reliance till now.
darshan said:
i want to know how to send free sms by computers on gsm & cdma mobile phones in india.
A said:
I have a t-mobile phone and I do receive SMS from RIM. I can also send SMS to RIM as 91+phone number@ri.irisme.net ...
Bobby Maisnam said:
Hi A,
I have a question. The RIM phone that you receive messages from, is it a prepaid one or a postpaid one? I can receive messages from postpaid RIM phones in India but not from prepaid RIM ones. My service provider is Cingular.
Thanks.
bujji said:
this is the best card i have ever seen.good connection and quality
hi there is no webs on net to send free sms to rim my exp.is about 2yrs old.thanks.if any told me drolga@rediffmail.com
joe said:
hi/
may i get a gmail invitation please?? please mail me at joe_hot66@yahoo.com
navratan said:
i want to send a sms to relaiance phone but it ddnt work
kunal said:
hy my GF has a RIM now i don know what to do, really need to contact her.
if anyone has any info bout a site with free dervice to RIM pl let me know
thanks
sucker
Eric said:
Hi i was wondering if i could also have a link. I have been searching for a while now and 4000 link sover at kevinrose.com were snatched undermy nose within a couple seconds
Toddehmke @sbcglobal.net put it together seperated for spam bots
Vaibhav Sharma said:
Hello everyone!
well this is my first posting in any forum, for all those people who are looking to send sms through internet to the mobile phones in india...try using http://www.mobilekarishma.com I bet u wont regret. It supports almost all the mobile operators operating in India, except Reliance where Reliance (kolkata) is the xception. And beside supporting the indian mobile operators it all also supports the operators of many different contries..counting from palestine to US...and you know what all that FREE OF COST!!!
Try it and if you like it do tell me by mailing on my e-mail!
Have a nice time to all!!
nitin patel said:
I have been ripped off by many name brand calling cards. relianceindiacall is best thing happen to me. I love using relianceindiacall card.
ankita said:
i want to send SMS from my computer to the mobile numbers of my friends staying in dubai ....the numbers starting 00971-
Hi Everyone, I want to send FREE SMS to GSM & CDMA Reliance India Mobile with in India. I have tried many sites but not get satisfection. If SMS sent to reliance mobile phones using the format 91+std+number@ri.irisme.net from a mobile phone. The message will delivered & if sent from a site it will not. In this case I want to know what is the need to use this particular format to send SMS Cant we send it using mobile normaly. Or if we send using above format is it free even after sending by mobile. If YES please tell me How can i have to save the emeil in sim card of mobile phone.........
please help me.
sophia said:
hii frens !!!
greetings ? how r u all? well, this is my first post and i am hopeful someone wud be able to solve my problem. i live in india, bhubaneswar. i wish to send a pc to mobile free sms text msg to a reliance mobile handset in ahmedabad, gujarat (both places inside india only). plz help me ...if anyone can give me any useful website link or info ...it will be much appreciated. mail me the ans to itslopa@hotmail.com.
thanx and have a nice time.
Naman said:
hey guys if find any websites from which you can send sms to RELIANCE INDIA (GUJARAT) AHEMDABAD Pls Email me on nsp909@hotmail.com
how to send sms from web to BSNL mobile in utter pradesh east pls reply if any one have solutions
thanks
Sarang said:
if any 1 wan'ts to know how to send free sms to reliance phones..mail me at verycute_poo@yahoo.co.in .... iknow the way.trust me!
naveen said:
hi, i m from australia and i cannot send sms to reliance in delhi. if any one knows how to send an sms via web please tell me. my address id singh_naveen2003@yahoo.com
Kamal said:
Hi all !!!
if anyone wants to send Free SMS to any mobile in India including BSNL and Reliance just goto http://www.smstoindia.com its a site which offers free SMS to BSNL & Reliance i have tried it out its nice and usefull . i hope all you folks will like that site ..
bye
Kamal
fromnh said:
T-Mobile phones can receive sms from RIMS...but I could not figure out how to save RIM phone # in the email format...I have Sony T-610 model
Kumar said:
From the US : You can send sms to any reliance Mobile phone from any verizon wireless phone by sending sms to 01191+(citycode)+(number). works great you can also receive from india.
Midhya said:
This is wonderful. It would be nice, if this can be avilable for 10c/MIN to India when compared to other providers.
Rajesh C. Makwana said:
Wonderful service, God Bless RelianceIndiaCall.
I was very tired with all kinds of calling cards, but now no more calling card, just Reliance, Reliance..
Thank you
Rajesh Makwana
Linda Colaco said:
Have been using Reliance India call for about three months now and the quality is good, but as mentioned by others, the rate should be lowered further to consider it as a price competitor to local providers like AT&T.
TMobile-User said:
Reply to fromnh and T-Mobile Users.
If you recieve an SMS from Reliance Phone in India. It will come from a 3 digit number ranging from 300 >...
If you hit reply The message will go thru and if u have delivery notification enabled, you will also get a confirmation. But Remember you got to reply within 24-36 hours. The 3 digit number expires after that. It is a temporary fate way established by the operator when it recieves a message from reliance in the form 91YYXXXXXXXX@ri.irisme.net where YY is city code and XXXX is reliance number.
and no its not free, it gets cut from your quota of your messages! and why the fascination for FREE! pay some money to get peace of mind that your message is going thru!!
Mustafa said:
Dear Friends,
Instead of blaming the web and searching for sites, i feel we can curse dhirubhai ambani for fooling people in the dhirubhai ambani pioneer offer....they are huge cheats more then our indian govt. cheated the people of india in broad daylight hahaha. change ur mobile to gsm - airtel or hutch...for a better service and international acceptance
bha said:
hi all
how to send sms to dubai from pc
pls tell me anybody
hi everyone try using www.FunTooZ.com for sending sms to Reliance CDMA in India. Though its a paid service but i don't 99paise is a burden on anyone to send sms. Works perfectly fine. FUnTooZ.com's gateways are the backbone of few above mentioned websites that give free or charge 1.49 Rs
Steve said:
(: Yes, they've moved and de-emphasized it :)
bob said:
RelianceIndiacall is THE BEST. Here are few SUCKERS
1)Razacomm
2)9278
3)Ringmycountry
4)Indiacitycard
5)SDI card
6)Letsdial
Yes Bobs, I like that song too! They really rock!!! I have the MP3 playing in my PC everyday. The lyrics is also good. "i'm not a perfect person..."
Anna said:
I love that song too! :) And I love Hoobastank too :D Another song that is really great, (been my favorite for months..) is " What Happened To Us?". Abolutely asume..Listen to it! :D Just a piece of friendly advice..:) c ya
shaji said:
hi friends,
Do u think any web site may help us,with out,charging money,never,all they want to lead us to such a situation,If anybody practically know any site to send sms to BSNL kerala,pls advice properly,by ur experience only.
shaji
mary said:
pls someone let me know how to send sms from pc to reliance mobile.
thanks
Raj said:
Relianceindia connection is good, but the quality is lousy (at least the place I'm dialing).
Chris said:
I would like one pleasssseeeee.
I have been waiting for gmail since google anounce it.
I want one pleaseee...
thanks....
email me at bgsince681@yahoo.com
Pooja said:
Excellent connection quality. Reliance has lived up to it's name. A rate reduction from the current 11.9 cents/minute would go a long way in this continuing to be the "most preferred" service as competition seems to be catching up soon.
The beauty of MT 3.x is the file hierarchy but you have (I think) decided to keep the old system. I think MT 3.12 was released recently though I am still running the beta of MT 3.12 on my site.
Hmmm, and I realized that you have set the option to moderate comments but somehow your re-direction is not working that properly. Then why not activate TypeKey Authentication too.
rao said:
its ok not bad
vikas desai said:
i can't get your website open
Giridhar said:
Hi,
So many people, somany comments, sooo many references, let me tell you something there is no such way (I mean direct) way to send an SMS from PC to reliance CDMA mobile phone. Yes the SMTP user is being created on the server when you have a reliance phone. (Please refer to www.network-tools.com select E-Mail validation option and enter the 91XXXXXXX@ri.irisme.net it is saying that the user is existing) and when I tried to send SMS message I am receiving that message. So there is something which we need to get through. Trying to get that information and the moment I'll get that I'll post the commecnt.
thank you and have a very great day everybody
Regards.
Rahul said:
the best site to send Free sms to BSNL and Reliance is http://www.smstoindia.com
from here you can send SMS to any mobile in india .. no other site can claim this sites status..
i can bet on this ..
Regards,
Rahul
Bobby Maisnam said:
Hi Brajeshwar,
Thanks for your comments. I have activated TypeKey authentication. But it still requires comments to be approved even if they are from TypeKey authenticated members.
Also, I am still having the file permission problem (MT writes as 666 and so the server does not allow it. It has to be 644). I guess I will try upgrading to MT 3.12
I am not sure which courier does Rediff Shopping uses but they were fast and on time when I did some gift transfer twice.
~~~!!!AnKiT!!!~~~ said:
Hi all...
so all u guys r hungry to send sms to Reliance India Mobile(RIM)..go to www.FunTooZ.com its really WorkS..On registration they will give 2 credits, so u can send 2 sms for free to RIM or GSM networks..rest u r smart enough...
You may alternatively hook to their live cvs so that you will always get the latest build but then, most of them are betas (I am sure you are not really interested in un-stable releases).
And for this kind of rush downloads, you can also try downloads.com or other public ftps which mirrors the same.
I got my copy few hours before it goes public, so it was fast and quick and I was waiting for the release on 1.0 already. Anyway, there was not much change from the 1.0 RC.
Bobby Maisnam said:
Brajeshwar,
Thanks for the tip. I will keep checking that link for updates.
[2] If you would like to start blogging without worrying about how to set up your own blogging software, you can get a free account at http://www.blogger.com/
- Bobby
Ranjith said:
dear sir,
My name is Ranjith Raveendran and I have one RIM pripaid connection at Kerala Tirur and my mobile no is 0494 3699762. and now the phone is at my fathers hand and I am working at Bahrain and here I have a connection provided by the network Vadafone and my no is 00973 36408973.
And what I am meaning to know you that I can recive the messeges from my phone from kerala and what's the problum is when I send sms to my mobile no 0091 494 3699762 they can't recive the messages when I asked about this with vadofone office the told me that is the problum of RIM network can you pls help to solve this problum in 15 day if yes I will not disconnect my reliance conection if you are not clearing my problum I want to give up you connection and try to take any escotel connection with in two weeks if you are not accepting my complaints I have lot of friends with RIM connection with same problum I want to say them as I mean before. expecting your replay soon.
Thanking for you
Ranjith Raveendran
Bobby Maisnam said:
Ranjith,
Suggestion 1: If your vodaphone connection allows sending of email messages, you can try sending email to 914943699762@ri.irisme.net from your mobile. That might work.
Suggestion 2: Send SMS to your RIM phone in India using http://www.smscountry.com .Note: This is not free. It costs Rs. 1.49 per SMS. But I guess it is worth it. The service is pretty reliable. I have been using it since March 2004.
And I guess you are confused here :). I am not an employee of Reliance India nor do I have a RIM connection. I just happen to have friends and relatives in India who have RIM connections. I posted this entry in my blog to talk about my experiences regarding sending sms to RIM phones in India through the web. Since MT allows comments, this has become sort of a discussion forum.
you can send sms to airtel, hutch and others on yahoo messenger. just log in and there is sms icon with mobile phone just type your number and it will tell you if it can or cannot send sms. go here to see which operators services are supported http://in.mobile.yahoo.com/new/messenger/
zahid said:
how should i send sms in dubai coz my brother is htere please say me or send me thisprocudure please
anand said:
i need your service. can u send me in my email address for your information. i am interesting your to india in gujarat at baroda
I have been very pleased with "the customer service and quality of calls" provided by RelianceIndiaCall.Com and its people. KEEP THE GOOD QUALITY.
Some cards are coming on the horizon to compete with Reliance with 9 to 10 cents without any fees.
Have you checked their offers(Specially hidden charges, surtaxes and weekly fees)
Your Account summary for each customer is really great since it allows us to see whom we called.
Since TWO DAYS I have not been able to open your website (relianceindiacall.com)
Best Luck/ Happy New Year
Ashvin Bhatt
melonie said:
hey.. hi
i wud like to know how to send a free sms to dubai from ur pc..
i've been searchin for a free service since months...
if anyone gets any info.. pls mail me.. at baibee_babe17@yahoo.co.in
thx...
Bala Krishnan said:
I have heard nothing but good things about Relianceindiacall.com
Some of my friends also report good results.
For a change, we can depend on a service that is offering quality service.
For those who lament about high price, let's be fair: You get what you pay for...!!
I don't mind high price (within reason) if the service is good and - I think this service deserves the present price level. Competitive forces will take care of the price.
I remember paying exhorbitant amount for poor quality service not too long ago. We have come a long way. Thanks to competition.
karthik said:
hi..CAN WE RECIEVE SMS FREE FROM AUSTRALIA TO INDIA RELAINCE PHONES??
roja said:
It is the BEST card out of all the cards I have used since so long.But it would be even more wonderful if we can get more minutes.
Narendra said:
Hi All, There is not site to send free SMS to reliance india mobile. I think reliance is a very poor operator among all the operator in india. I cant sell or change my phone if i am a user of RIM. Please tell me if anyone know how to send FREE sms on CDMA phone...
The view of this site immediately introduced a train of ideas into my mind! Nice Site! You may visit my wonderful site!!! http://gamadzoba.com/ (see attentively).
hi all!!im' not sure of an sms to reliance mobile via pc but im' sure of FREE sms to any mobile in the world via ur hutch gprs enabled mobile phone!!This hack is tried with prepaid and postpaid,its under trial!!smses even to 8243,7337 and even 00971......... are also free.no charges.for details check my site out::www.kirankonathala.tk,some mobile hacks there!!byee
akaash said:
does ne one know 2 send free sms from airtel kolkata GPRS ENABLED PHONE(NOT MMS) .COULD BE THRU SOME SITE OR EMAIL.GUYS PLZ HELP
Subrata said:
Want a gmail account. Pls send me at sbaguli@timberland.com
Don't be taken off my Hollywood movies using Indians/Indian Names these days; Remember the Indian Families in Matrix, Parvati in Harry Potter and the Prisoner of Azkaban, the importance of the Goan location in Bourne Supremacy, et al.
sms2india is not giving free sms to bsnl and reliance.. they are also cheating.. the rahul, who posted the comment saying that sms2india gives free sms to bsnls/rim is a cheater..
Ali Koya said:
Let me know some of the workable free sms to mobile phone site to (1) India (2) to the world.
Rgds,
Ali Koya
Abu-Dhabi
Mohit said:
Meetul.Com is also a good website for sending SMS to GSM phones. Though they dont support Reliance but being absolutely free and beoz they dont ask for registrations, they are my favourite.
NASSER said:
Mbl no.starting from 919865 is not working in pay sms also what is the reason.
I had booked a domain with them for Rs. 350. I sent them the same amount for renewal. They did not renew it for about two weeks, and then sent me an email-- just two weeks before expiry of the domain, demanding Rs. 450. I cancelled the order, but they did not return the money. They also locked the domain. They did not respond to my emails in this regard.
They are resellers of directi.com, and so, I sought intevention of directi and got the domain transferred to another reseller. Directi declined to intervene regarding refusal to refund the money and suggested that I approach cyber police or Consumer Forum.
sriram said:
i want ring tones to mobiles.i think it is better.my number 9346265032.
amit said:
hi ,last 1hours i am trying free sms on reliance. there is no site for relisnce anybody know hoe to send free sms on reliance mobile give me the link of it ok thanks
Cesar Gadea said:
What can I do to connect and send and receive email?
Umasankar said:
Use sms.ac to sms to maximum GSM phones in any place of the world.
But it gives only one msg. free per day.
It works exactly.
Sudesh Kapoor said:
It is the best connection for India. But rates should be lowered with more time to talk with one whom you love more. I mean more love more talk time.
sarat said:
how to download ringtones in reliance mobile other than the r world ones
Can any of u tell me from which site i can send free sms to BSNL mobile in chennai.I tried smsto india...its not working.
Info said:
Has anyone tried sending SMS from Sprint PCS phone
in USA to India ?
Is anyone with Sprint PCS service able to receive SMS from India ?
JAVED SHAMS said:
i received a document from patna in 3 days , where as first flight told us that it will rech it's destination i.e delhi within 24 hrs.
javed shams
delhi
JAVED SHAMS said:
very poor service by first flight
prerna said:
hi....
i just wanna know how can we send free sms through web to reliance india mobiles..../?guys im sick and tired of asking this question again and again....i don't even know how many times i must have asked this....but plz guys ...only u can help me out by suggesting something....Is there any site which is FREE for sending sms through computer to reliance india mobiles...i have a postpaid RIM....
plz let me know on my id...prernabakshi@hotmail.com....i'll be waiting for ur reply....
regards....
satish said:
Yes, Quality and connection time is very good. However, there are minor flaws in the network design.
1) when I accidentally enter a wrong pin or wrong number, it doesnt ask me to enter again. All it does is, disconnects by saying, thank you, goodbye.
2) If I associate a pin with a phone, and if my balance is finished, I cannot use another card(friends card) using my phone. This sucks big time.
Else everything is good.
Satish M
Keyur said:
Priya,
You can send an email to any mobile user in india (except BSNL user) from your Sprint PCS cell phone.
Email addresses for different service providers are,
hutch/celforce: mobilenum@celforce.com
Idea/AT&T : mobilenum@ideacellular.net
Reliance: 91+std+number@ri.irisme.net
Airtel : mobilenum@airtel.net (not sure of this one)
For someone to send you an email, your email would be yourcellnumber@sprintpcs.com
Hope this helps.
Milind Alvares said:
you enlightened me man. I was always confused as to why that i.e thing was that is. Never bothered to find out though.
you can also use yahoo messenger to send free sms but seems yahoo does not support all.
enjoy.
Sumit Garg said:
Very poor performance...
Its acceptable that the networks were busy so I could not connect. After trying several minutes, I was able to make a call. But on my second call to India, it either will not connect or will keep telling me "Your account is already in use".... Called customer service. Waited for 15 minutes, got a representative, she took my number (which is stupid becuase I already enteredd it when I said I am an existing customer (remember Press 1 if you are an existing cutomer??)). Ok so she takes my number and then doesn't answer for another 5 minutes (hear the irritating music) and then I automatically disconnect!!!!!! This sucks!
I have been a customer for so long making frequent calls but I will no longer use Reliance India Call anymore and will not recommend it to other people like I used to. Very poor performance. A failure!!
IT STILL SAYS CURRENTLY IN USE 50 MINUTES AFTER I HUNG UP MY FIRST CALL!!
Nayan said:
I think govt. should stop the service provider like firstflight. They are shukkkkkkkkkkkk.
kps sran said:
what is the calling rates for india from vancouver
But wat abt reliance msging..? Now reliance has a 10 digit no. 93xxxxx format. How do we send sms to this?
Can the author throw some light on this?
Bobby Maisnam said:
Meera,
I think the format now will be 91+93xxx-xxxxx@ri.irisme.net. However, I have not tried it yet. So, I am not sure.
I mostly send my messages using smscountry and in that, both number formats (old area_code+number format and new 93xxx-xxxxx format) work.
HTH,
- Bobby
nelson said:
hi guys !! i tried sending messages to BSNL (J&K) and reliance delhi , from www.funtooz.com, the message shows it went thru . check it out whether it actually works !!!
CHOWDARY said:
here lot of guys gave wrong information. but here i am giving 100 percent gunine.
for Andhra Airtel mobile: number@airtelap.com
for chennai airtel mobie: number@chennai.com
for karnataka airtelmoble: number@airtelkk.com
for Mumbai airtelmobile: number@mumbai.com
its 100 percent correct, u can try from ur email just type in too address. suppose u have to send a sms to number at andhrapradesh. just type in TO collum
Spaceforhost.com has since refunded the money paid by me (Rs. 350).
Prashant said:
Hi friends,
if you need bulk SMS service than check out www.myhostworld.com , the site offers bulk SMS services to almost all Indian networks including BSNL, MTNL and Reliance
i want gmail account plz send me gmail account at eagle_ivy@hotmail.com
Regards,
Imrna
Jayeshkumar said:
RelianceIndia can talk India very good.
Shibaram said:
I am yet to receive a letter from Delhi which was sent on 12/01/2005 and whenm i give them the tracking number they say we dont have any information on it.
God!!! if someone walks from delhi to bhubaneswar and delivers it to me it will be faster i feel.
suckkkxx.. indian postal services is faster i believe.
prateek said:
hi
can i sms from com. to mobile relaince number- 3956435
TO send free sms to reliance mobiles from your PC just logon to www.smstoindia.net
this site offers you free SMS to any mobile in India including BSNL and Reliance mobiles ..
This site is very usefull for NRI who want to be in touch with their people in homeland . just visit and enjoy SMSing
Kay N said:
i get error 999 everytime i try to get yahoo mail and i want to know why.
Philip B said:
my test showed me at 5440 kpbs. I'm on Time Warner premium RoadRunner.
nitin said:
can i sent sms to reliance through internet with in the country
pls search it and plsinform me 9324318429 thisis my cell no
Steve Dsouza said:
first flight service is best as they told me my tickets will reach from mangalore to north east in just 48 hrs which was containing international air tickets and it reached on time. i didnt took much efforts to consult with customer service. thanks to first flight couriers and all his team otherwise it was impossible for me to travel.
Amit said:
Hi
I dont understand what u mean by sending thru Mobile email! Is it setting up SMTP/POP mail on GPRS enabled Mobile, and then sending it? Even in that case the Mobile uses the SMTP server of Yahoo or Gmail which are ordinary email servers.
What do you mean exactly. I'll be extremely happy if u could be a bit clear on this "Mobile Email" thing.
Thanks in advance
Amit
sandeep krishnan said:
hey guys and gals
gr8 news now you can dowmload all the latest old very old english ring tones on your RIM
go to indiatimes.com and in that go to ring tones and enjoy downloading on ur phone.
for more information mail me on reliance_engineer@mail.com
Most of the SMS to Mobiles is listed in this site http://www.a-iss.com . Airtel, Hutch, Riliance, BSNL, Tata, etc
Akshita said:
Please help me to send SMS to reliance from Internet.
sruhtysyam said:
its nice
neeraj said:
sir,
I want to give the facilities for my website for sending free sms in india, can you give cmplete webformate of indian sms provider so that I can send free sms through my website including bsnl and reliance, please send me way for this work.
Eric said:
Google's new Video Search is still pretty raw. It's easy to use, but that is about it. It is quite frustrating to find a segment of video but not be able to view it. I have checked out a few new services and so far, I like BlinkxTV. Check it out and see for yourself. It is just as easy, if not easier to use than Google (especially if you can't remember the name of the show or program) and you can actually view the segments of video you find.
www.blinkx.tv
k p naidu said:
hi bobby
my name is kp naidu rel no:09342574748(bangalore) now i am shifted mumbai. i came today. but problem is last 15 day i could't make outgoing and incoming calls. Error msg is : to recive this service plz contact reliance costomer care. last 15 days, daily i cantact reliance costmer care but no response. this is prepaid card and sufficend balance.
kindly imediate response to me
regards
kpnaidu
abhishek said:
hi..
i m abhishek. does nebody have ne idea how i can get to know bout the city from a reliance 93xxxxxx no.
I agree funonphone.com sucks. The best site to send free sms in India is http://www.aasma.com/ . Its Free and supports reliance also. I can send upto 150 SMS free every month (5/day). But funonphone.com sucks.
zohre said:
I wanna send sms (free) from Iran to a hutch mobile in delhi/india ...will U help me ????
Hi, This is murali krishna. It's very nice URL. But I want to Send SMS through web site to Reliance India Mobile. But I'm unable to send. Please Help me out.
anshul bhatnagar said:
how can i send sms through email
Sandip Mahajan said:
Hi guys,
I think u are all fukkad type of people, u dont have monies and try to be smarty!
In india we call these type of people BHIKADDE & RIKAMCHOT
Just think how can one provide free when it's costing them, will u give ur any thing free?
call me on +91 9823322331
folacomputer said:
I got error 999 anytime am trying to log in into yahoomail. What is the solution?
Jeremy said:
Please stop the Error 999 because I want to log in to my yahoo account
colin b said:
I cannot acess my email due to 999 error. please help
kishore Kumar said:
dear sir,
i want to know relaince mobile codes in kerala area wise.
iam waiting for ur favourable reply.
Regards,
Kishore Kumar,
Jenny said:
"She looked absolutely gorgeous!"
I thought that you said that she looked "too perfect." :)
can anybody give me an idea how can i send free sms to a bsnl mobile withou have gsm or gprs connection, please comment urgently a girl from vadodra
gita said:
hi sir there are some miss call is coming on my cell so kindly u help me by giving these 93235473996 mobile number and adderess of the person plzzzzzzzzzzzzzzzzz your thankfully
gita
sajal said:
Is there any reliable site to send sms to Airtel kolkata and Hutch Kolkata . I tried so many sites but that were not working . Smsjunction is a nice site I tried it for a hutch phone but for Airtel it does not works . Please Help me
raghu said:
sir
i am getting calls from 9346266197 plz give me the address of this number.
Vinay said:
How do you set up a blog on your own domain name?
esha said:
hiii wut is std code like i know ur suppose 2 use 91 ... then the std code and then the no but wuts the std code suppose 2 be plzzzzzzzzz help !! thank u
Bobby Maisnam said:
Hi Esha,
Since Reliance has converted all old numbers to the 10-digit cellphone format, I would assume that you would have to use 91+phone_number. No need of STD code.
So, if the number is 98313-12345, use: 919831312345@ri.irisme.net if you are sending email from your cell phone or 011-91-98313-12345 if you are calling up the number.
Absolutely ! She looked awesome I should say. But there was some problem with her accent.
esha said:
hii thank u so much but i tried sending this from my cell ph its a nokia 3587i and its a prepaid ph.. my service provider is alltel. so i tried sending my message but it didnt reach the person i was sending it 2 does this usually happen?? and i was wondering if i cud send it as and email from an email address
Bobby Maisnam said:
Esha,
Well, it works for me. My provider is Cingular.
However, for quite some time, I have been sending less messages using my cellphone and sending more using http://smscountry.com/ .Messages sent through them always reach without any problem. Also, the rate is very cheap - 3.2 cents per message. If I send from my cellphone, it is 10 cents per message.
If your cellphone has an email address, you can set that up as your contact email address in SMSCountry. That way, when a Reliance user in India replies to your message, you will get the message on your cellphone. That way, it is better for them because they spend less (Rs. 3 for SMS to the SMSCountry number is Hyderabad vs. Rs. 5 to send an international SMS)
HTH,
- Bobby
Olumuyiwa Lanlehin said:
I get the message error999 everytime I try to open my mail on my laptop.
esha said:
hi thanks im going to try and use sms country i tried to buy credits i was just wondering how it works the shipping address do they like send a card home or sumthing or do they just grant u credits on ur computer thanks for the help really appreciate it
esha
ohh and wid sms country can u reply back from ur cell phone ??
Bobby Maisnam said:
Esha,
SMSCountry credits are added directly to your account. I think they manually activate the credits and since they are based in India, it takes about 10 to 12 hours for them to activate it (I guess they might activate faster if you buy the credits when it is daytime in India)
No, you can't reply back to the sender using your cellphone because the notification email (with the message in it) is coming from SMSCountry and not from the sender.
HTH,
- Bobby
esha said:
hii im sorry for all these questions but i really need this umm soo it says 149rs soo do they convert that into dollars when they take it out of your account ? how much does it convert into thanks for all your help !!
esha
esha said:
hii wut do u think of this website i think its sorta better http://www.ipipi.com/index.jsp take a look and tell me wut u think
Bobby Maisnam said:
Esha,
Your credit card will be charged in INR. It will be converted into USD by your credit card company. The last time I recharged (Nov 2004), it was USD 3.68 (INR 164.20).
No idea about ipipi.com
HTH,
- Bobby
fasi sahil said:
plz tell me how to send free sms to bsnl and reliance india mobile
Ranjith said:
Yes. The accent is different, it's not a problem. You cant expect her to speak in Amercian or British accent, because she in an 'Indian'.
joy said:
plz send me free to sms from reliance phone URL.
Arunima said:
Hii .. I have tried so many sites to send sms to airtel kolkata(calcutta).. meetul.com and smsjunction.com works fine for hutch kolkata . but it's not working for airtel kolkata . Could u please help me ? Thank U .. have a nice time
Neha said:
please tell me a reliable site for sending sms to airtel maharastra and Airtel kolkata .. pls help me !!
sandeep said:
sir
i want a site from i can send mszs , tones etc that contain maximum providers include delhi mtnl for free.
how i install lotus notes and domino server.
please give some details about lotus notes and domino 6.5
Asheesh pawanjai said:
Hello Sir,
Sub: - Mail is not Send through outlook Express.
We have used the Internet of the Vsnl Company for mail check through outlook express. We have purchase the reliance cordless connection that’s instrument model no. LGE CDMA for mainly use for mails checking through outlook express. There can be receives the mail but can’t send. Please tell us your pop no. & smpt no.
Please this problem solved out as soon as possible.
_____________________
Note from Bobby (8:57 AM 2/26/2005): This comment is not directly related to Reliance SMS but anyway, I have allowed the comment to be posted here. If someone has a solution to the problem, please post it here or email Asheesh at pawanjai@vsnl.net
Gena said:
"Chewing gum in Singapore is as bad as bringing a gun into Singapore"
esha said:
hii the website mentioned above http://coldfire.95mb.com/sms.htm does it allow reply backs 2 i mean i cant c how they wud allow replys
I am not sure if they allow reply-backs. But they do send a copy of the message to the email address provided. And they do not allow SMS to Reliance cell phones (9312x-xxxxx)
What are your most preferred calling cards? (ofcourse, other than relianceindiacall)
Aalfred Kyne said:
hi sir
thank for the inproved in the yahoo.com . for now we are not geting yahoo mail in some part of libereia.
Amritpal said:
she did nice interviews, but i had a feeling there were some attitute problems flying around.
divian said:
i dunno people... she's a little full of herself off late... she's got an accent and a put on smile with that wannanbe 'monroe' attitude.
All i m saying is she's changed and a "dogs collar and leash is not needed on a cat"...
Shikha said:
Aaaahh... after trying all the websites. I find www.aasma.com the best for sending sms to almost any mobile in india. Also you get 150 free sms every month. you can send 142 characters sms's. Its a cool one baby
Esha said:
hii in smscountry. com is dere a way u can sms from u cell ph i know u can reciev smses to ur cell ph but u can send em from u cell ph ??
No, you can't send SMS from your cellphone using SMSCountry.
HTH,
- Bobby
Sultan said:
We are 1 of the leading SMS Value added service providers in UAE .
We terminate millions of SMS for UAE and SAUDI ARAIA Networks.
Currently we are looking for a good prices on bulk volumes to reach this countries.
Chang said:
I first thought that my school has blocked yahoo mail, Now I realized that everyone is having the same problem. Anyone knows a solution? BTyahoo never worked for me.
suresh.A said:
I want to send messege [via computer] to start the mobileno.922 in india.this mobile no is in surat.plese found the web site name.
suresh.A said:
I want to send messege to start the mobile no.922 in india.this mobile no is in surat.plese found the web site name.via net.
Naveen said:
hi
i want to know wat is the best way to send free sms to reliance mobile phones
if any body knows then please reply at "agarwal_nc@hotmail.com"
prashanth said:
I am having reliance prepaid mobile .how can i download various ringtones from the websites free.
Please sujjest me some famous websites also .
Tarang said:
Meetul.Com is best for sms in India.
I have been using it for over a year and I have never experienced any problem from their side. And as Mr. Ati Koya said, being free, they are my favourite too.
Tarang said:
"hi what network mobile is +91 135 .......? Is 135 a reliance mobile phone? my friend reside at Dehradhun, what cellular network are providing there? Do you have any knowledge what website for free sms for this network please let me know i need it badly"
+91 135 is the STD code of dehradun. I live in dehradun, here BSNL (DOT/Landline) and Reliance phones use the STD code as a prefix before their numbers.
Akhtar said:
Yes Aasma!, www.aasma.com is the best website and their paid plans are also good. The best part of it is that SMS are sent from your number as sender, that means just like if sent from your mobile.
thanks to this forum now i can send free sms to reliance via rworld on rim & web. BY USING RI.IRISME.NET THROUGH THEIR NETWORK I AM ABLE 2 SEND SMS TO ANY MOB NETWORK IN THE WORLD.
Dheeraj Thakur said:
U CAN C MY POST IN ESATO FORUM, WAPOC.COM & LEECULT.COM (WAP SITES). TO KNOW THE TRICK WITH COMPLETE DETAIL SEND ME EMAIL WITHOUT ATTACHMENT
HI,
I WANT TO KNOW IS THERE ANY WEBSITE FOR SMS TO RELIANCE INDIA MOBILE(RIM),WITH OUT TAKING ANY CHARGE,AFTER REGESTRATION/MEMBERSHIP i.e. TOTALLY FREE.
Mayur said:
How to send sms from the web to Reliance India Mobile in mumbai for free....
I'm getting the 999-error, what do I need to do? Looks like others have had this also.
jessica said:
hey, i have a question. i've been searching around all day for sheet music that matchs up with the song Mariage d'Amour that is on your blog, but i can't find it. i've found senneville's sheet music, but not the sheet music from George Davidson for the song Mariage d'amour. do you or anybody have any idea on where to get it??
Many Free SMS sites are using Email 2 SMS Technology which is now often blocked by cellular operators.
www.funsms.net/freesms2india.htm
I think when sending sms to your frens go for free sms site which use sms gateways instead of email 2 sms technology.
For example in Andhra Pradesh, India...Idea Cellular and Hutch have blocked the email 2 sms technology and when you send sms to your frens in these circles through a free sms site using email 2 sms technology....it will never reach them.
so becareful while sending serious msgs through net. Better send from your mobile.
I love Plone and Zope combination which I have powering my website at www.sebpayne.com. Many companies will provide you with Plone hosting (already setup) on a server. http://www.objectis.org/english offer free hosting with a preconfigured Plone server. I'd give it a go.
Thanks for the detailed article (and for the link to my article :-D). I found some very informative links from this. Did you see http://yagoohoogle.com ? It's cool. Check it out. Luv, Jo.
can anyone help me to know a website to send free sms to saudi arbia n dubai..plz help me
Srinath said:
Friend,
How to send FREE SMS to BSNL OR TATA. Please email me as early as possible.
If possible i also want to send free sms to other countries free please help me....
Thx's
Vishu is not on April 15th, but 14th. It is considered to be the first day of "Medam" (the first month of the year). Also my Amma's (Mother's) birthday. :-)
Regards,
Jo.
divyangbhai panwala said:
how to send message computer(net)to mobile
bharath said:
can i send a free sms to the below mentioned mobile number
0094777295224
Pradeep said:
Hi
Can anyone tell me how to SMS from PC to a landline phone which has SMS facility (like TATA Indicom Walky)
Thanks
Pradeep
Robbie said:
Hi Friends,
Well all the Reliance Mobile Holders are wasting theire time here there is no way to send SMS via any site for free i have tried
To: 91409392443962@ri.irisme.net but still it does not work if you are paying to enroll with a paid sms site still its the same amount on sending through your mobile. I sugest that send sms through you cell phone only the cost is the same via email.
The above is only a sugestion to Reliance mobile holders.
Trish said:
I keep getting calls & texts from one of these numbers, but I do not know anyone in India. Is there any way that I could find out who is sending them to me?
daipayan said:
Hi,
I am having some trouble sending sms to reliance india mobile from america. everytime i sent, i get an error "/not sent: too many possible reply addresses"..... any help is appreciated.
Now the problem to send free sms without need any login is solved thru http://cyberhut.uni.cc/
this supports reliance / airtel / bsnl and many more network in india. just go through the site.
nithya said:
Hi,
Is there any possibility to send sms from net to reliance landline phones
Gopinath Majumdar said:
Can anybody tell me How to send SMS to reliance prepaid mobile successfully using HUTCH connection.When I send SMS to reliance mobile most of time they are not delivered.
Sorry,I am not GOOD in English
GOPI
Anil said:
check out www.wickedsms.tk
you can send free sms to reliance!!!
it works!!!
nithya said:
Hi,
How do i send free sms from internet to reliance landline?
nithya...
rohit said:
hi friends!!
cld ne 1 tell me how to send sms to BSNL using SMTP.... plz tell me the domain on which bsnl's mail server is running and the email format..
Thanx in advance
i use reliance landline WLL phone as modem. outlook express as email prog.
VSNL account.
What is the smtp server name of reliance?
since my outgiong mails are blocked.....
Deepa said:
hi this if for priya and all others...sending SMS TO RIM FONES THRU SPRINT CELL FONES.
i tried the number@ri.irisme.net and it works . my FIL has a RIM fone and he replied to it and i got the sms. as ri.irisu.net. so this thing works.
CAN ANYONE TELL ME HOW TO SEND SMS TO 9869( MTNL) fones and send msgs from there to here?
Tintin said:
First Flight Courier service is worst .. i have ever faced .. Never expected this in a city like Bombay .. The fellow comes down to my place and not finding me there .. goes off without even a note/slip mentioning that he had come .. the security informs me about him .. and morever nobody picks up the phone at their Sakinaka Office (Corporate)..frustrating ..
Brenda said:
you are my freaking hero, ive been looking for George Davidson's full version of Mariage d'Amour and up until now i've only found wussy clips. you have superb taste, and your links are good too :) (as in theyre not crappy scratchy quality type links)
mahi said:
Hello im, mahidhar i want know my friends mobile number in relaince...I try to called him but iam geting message the find the new number and tellig this web site address but im nnot geting can you please help me man
thank you....
0091-877-312-7095
hello all
my name is "lucki rj" i'am a telecom engg, i wood like to address about sending sms to reliance phone from a website.
reffer this sms format" 91xxxxx@ri.irisme.net"
this sms format only support reliance telecom which is based on GSM teachnology network in "Assam, Bihar, HP, MP, NE, Orissa, Punjab & WB" Only
but notes: Sms can't be send to Reliance India Mobile which is CDMA based network all over india, B'coz RIM has no web enable SMSC config on there network till now.......
plz replay me back with your feedback on my e-mail id
You're amazing Bob! Is there anyway to do this from a Win2000 machine?
Regards,
Jo.
Sharad said:
Hi,
I am having a strange problem with my tmobile cell phone. I recently changed my cell number. Ever since I changed it, I am not able to receive calls from India. I tried contacting 3-4 people and asked them to call me on my cell and all of them replied back saying that they were not able to reach me. When they tried to call it always said that "the number you are trying to reach is temporarily disconnected or not in service". They can easily contact cingular or other phone service providers. My old number worked fine without any problems. I tried contacting the customer service but still no luck. Have anyone faced the same problem before. I would really appreciate your feedback and suggestions.
Wasim Saiyed said:
Well, I also had poor experience with first flight. The First Flight fellow came to a location which is just 1 km from my address (somewhere in Ahmedabad), then he couldn't find my address so, went back even though he had my mobile number. I called those guys on the same days and explained them how to reach my address, so the next day finally I received my consignment.
This was something bad, but the first flight can't beat Professional couriers in "Poor Service".
I sent a courier to Ahmedabad from Pune. It has been more than one week, but no one knows what's the status of the consignment. Since last two days I have been calling these guys but no useful response.
Now onwards, I will never ever use for First Flight or Professional Couriers for anything.
raja khalid said:
iam facing invalid password and id error and also 999 error when trying to log on to yahoo email
hey buddy, it is nice thing. but do u know anything like this for windows?
I will be thankful to u if u provide so.
anonymous said:
Bobby...i think u need to see the website of the person who has commented above (Dhiraj)...i think u will find the last couple of posts straight out of ur blog....including the script that he supposedly wrote!
Ratish Reddy said:
Hii Sir,
Can I send free sms from pc to a Tata Indicom (walky phone ) which has the facility of sms, if so can u pls tell me the process for which I will be highly thankfull to u. Its a problem of love, that's why I need it as fast as possible, hope u understand me Sir,,
lucki rj said:
hello all
my name is "lucki rj" i'am a telecom engg, i wood like to address about sending sms to TATA Indicom phone/Walky/mobile from a website.
but notes: Sms can't be send to TATA Indicom phone/Walky/mobile which is CDMA based network all over india.
reffer this link for Coverage information http://www.tataindicom.com/roaming/index.asp, B'coz "TATA" has no web enable SMSC config on there network till now.......
plz replay me back with your feedback on my e-mail id
abbas ladak said:
hi how do you manage to sms from cingular to reliance mobile phone in india mumbai
Now,
anyone can send free sms to orange in india free of cost and without need any registration from the portal http://cyberhut.uni.cc/ this portal also support Airtel (Some region) / Hutch / RPG / BPL / IDEA / ESCOTEL / AIRCELL / CELFORCE these all free of cost.
Hi I tested this site with RIM (Mobile & landline both) & GSM : Smart Airtel & idea ALL SMS ARE SENT sucsessfully but u have a valid indian mobile number to get ur Password BUT IT IS FREE
www.digi-help.com
So Try www.digi-help.com
Thanks & send me message if this site help u
sanjay said:
try for reaching airtel kolkata thru web by clicking...
net2cell.airtelkol.com/net2cell/jsp/default.jsp
it'll sure work...200% gurantee....
if does...plzz acknowledge....
lucki.rj said:
hello all
I'am back with a good news, i have found a web site where in u can send free sms to any operater worldwide including "Reliance IndiaMobile" & "TataIndicom" just login to http://www.nonstopsms.com/ registor over there & u may get free 2 credit, which u be able to send sms to any operator in the world. chk it out for more credit http://61.247.255.186/communicator/pricing.htm
this is a chennai based company which offer bulk sms soluation too, so friends send free sms from this website, when credit are finesh then registor again with deff user name & get some more sms credit free.
plz replay me back with your feedback on my e-mail id lucki.rj@gmail.com
Viktor Takacs said:
Feature 4umail.net Gmail Yahoo Dubmail.net
Size of inbox 4GB 2158MB 1GB 250MB
Send Limit Per Day Messages 500 100 30 15
Send Limit Per Day 500MB 150MB 30MB 75MB
Max Message Size 150MB 10MB 10MB 5MB
POP3 YES YES NO NO
IMAP YES YES NO NO
WEBMAIL YES YES YES YES
Anti-Spam YES YES YES NO
Anti-Virus YES YES YES YES
Auto-Responder YES NO NO YES
Auto-Forward YES NO YES YES
Inactivity Exp. NO YES YES YES
Pravin B. Dhayfule said:
Hey Folks,
You can Sign up at http://www.rimweb.com where you can get solution to most of ur reliance based queries.
Bye
Regards
Ajay Bachani said:
Now you can send limited (only 5)sms from your Pc to Reliance RIM phones via Yahoo Messenger, but cannot reply back from your RIM phone. Says "Invalid user". Can anybody help to resolve this??? The reply number shows 8242801 on my RIM mobile when I receive from my yahoo messenger. Messenger needs to receive atleast one reply from the mobile to allow another 5 SMS to the same number.....
Now you can send free sms (upto 5) to any reliance phone from your yahoo messenger. To break the limit of 5 per number you need to receive atleast one reply from the receiver which is not possible from RIM phone as the outgoing number is 8242XXX and it does'nt supports it
manjarita said:
Karthik ka mamaji...congrats
tray said:
hi! u all. finally i think i got a 1 point solution 4 all. u can send sms 2 any mobile no.s including reliance and that 2 for free ( only 2 sms per day). go 2
www.aasma.com and join in. its really gr8. and do tell me your xperience.
bye.
I also have a bad experience with these guys, very unprofessional in after-sale-service. I own the site www.icsrdc.com, for the last 6 months, this site will be unavailable at random point of time, whenver contacted for reporting the same they said that they are able to get the same I am not because my ISP is different or the update of server records is happening slow for my ISP etc. In reality the site's DNS server will be out of service and it takes some time to update the same, its really foolish to host a site of commericial value with these people... ITs a price I have to pay for the lower cost that they ofered. Many a times the mails attached with this domain also bounces
Arun Sasi said:
Sir,
I want the details abt buying a domain and hosting pls send the details as sonn as possible
try this site, it offers a list of free sms text sites to all countries, sms to india and sms jokes also. www.smsufree.com
Raju said:
Hi every body,
I want to send SMS through my PC to an IDEA mobile (at Hyderbad). Can some body tell me the free and better method. I want to send 1 SMS per day.
sammar said:
smstoindia is a faltoo web site it does not work......i dont know any website from which i can send sms free in india....can any body refer a good site which is reliable and can work wid hutch too
sammar
PAKISTAN
http://cyberhut.uni.cc/ is again providing free sms to reliance without need any registration.
Dr.Seethalakshmi said:
Rediculous service ,first flight, I sent an important document thro first flight to canada, Address was written correctly on the cover but the person received the document had written the country name as UK and the document is misplaced somewhere and i lost an important opportunity
sea said:
i live in france and want to know how to send a sms with net to RELIANCE PHONE ?plz (9193......)
I am very new to this site. I have a problem with the hosting company spaceforhost.com. I have hosted 4 sites with this company.
During the last 3 months I was facing problem with them. Sometimes site is not available or email is not accessible. Now my site is up without header and footer. I called them up and no response.
They claim to have online technical support but no one will be available, if anyone comes they do not respond well.
Today I called their office twice, wasted my money. One fellow just kept phone down. They did not even bother what I wanted to say. Now they just say that they are not responsible for the data. If I need the website, upload all the things again.
Do you people think it is right attitude to say this….
Please do respond with your views… I am in an awkward situation since I do not have the back up.
They did not inform that they are planning to do some changes, if so I would have taken the backup. If it is some virus attack I can understand if they say that.
They could have informed me. Now they say it is my responsibility to keep the back up. Don't the hosting people have a back up? One day if the hosting company say we do not have anything. or site. how a company having good reputation exist..
I am living in India, is there any rule related to hosting in India? If anyone have idea please inform.
Jinson Karedath
AartJ said:
How such a simple posting can save a day! :-) Thanks, Bobby.
I thought its a prequel to all other Batman movies. Can't wait to see Mr. Nicholson as Joker again!!!
Mohan said:
I have been using relianceindiacall for more than 6 months now. Their rates are competetive and the call quality is ok. Some times it is good and some times bad, you get gaps in the voice and you will miss the communication.
I say I would use at least until I find a better one.
kashif said:
hey iam kashif ihave gsm mobile so iam have sms free
SURESH said:
sir ""I WANT SEND FREE SMS TO MOBILE IMMEDIATLY.THE MOBILE NO IS 9228132546.ITIS WORKING IN SUTRATH CITY.PLEZZE FIND THE ""WHICH WEB IS SEND FREESMS TO THIS MOBILE"".
R. Karan Kirti said:
Sir,
Can anyone tell me how to SMS from PC to a landline phone which has SMS facility (like TATA Indicom Walky)
how to send free text message from pc to mob from pakistan to uk
Guru said:
Hi Bobby,
I am Guru - heard a lot about you from Pushkar, Damu and Mama (Nitin Tiwari). Reached hear from your Orkut profile. Interesting trivia you got here on domain names.
BTW,
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
is not just a village in Thailand, it is the fully qualified Thai name for Bangkok city. As per Lonely Planet, it means "The city of angels, the great city, the eternal jewel city, the impregnable city of God Indra, the grand capital of the world endowed with nine precious gems, the happy city, abounding in an enormous Royal Palace that resembles the heavenly abode where reigns the reincarnated god, a city given by Indra and built by Vishnukarn (Vishwakarma - builder for the Hindu Gods)."
The name was so trippy that a local rock band made a song outta it. They just kept chanting the name again and again throughout the song!
Cheers,
Guru.
Abhay Bhise said:
If any one using Reliance India phone and not been able to send e-mails through their VSNL account, contact me on hightechpune@sify.com or 09822879883 (Pune) I have a solution for this problem.
Thanks
There were extremely excellent and the best scenes in the movie "Revenge of the Sith".
Good originality and great imagination, great story in this movie!
Here's Photo gallery for Hayden Christensen(Anakin) of this movie. http://www.imdb.com/name/nm0159789/photogallery-ss-0
I love Star Wars series the most!
kirstie said:
can anybody email me with a site i can go on and get unlimited sms to mobiles from the computer without paying or downloading??
Reena said:
Hie Guys and Galz, reliance SUCKS... I'm being sent monthly bills of over Rs 1600 a month since over 8 months... I stopped paying reliance any payment 6 months back... and all my bills are due since then... I don't even make 100 phone calls a month... most of them are only local calls to my parents.. I'm sure if a call costs even Rs. 4 per minute , then my bill should not be more than Rs. 600 a month... But I'm being sent bills of over Rs. 1600 since over 8 months.. The worst part is... they don't send you a list of local calls you made.. Also... if you know... several of my own reliance user friends also realize the same...Reliance is still charging for all unanswered calls... That means.. you just make a call to a number, and even if its not answered, you will be charged of the duration you kept waiting while the phone waas ringing on the other side! Want a confirmation ? Just dial your own reliance number from any STDPCO... and you'll find that reliance network is still cut off from BSNL.. This way, all people on all sides are being falsely charnged while these companies making crores of rupees in a single day FOR NOT PROVIDING YOU A SERVICE...
Isn't this rediculous? Are we all ASLEEP ? If something such had happened in USA then the company would have already received thousands of lawsuits againts them by now...
mohammad said:
hi im mohammad i have mobile sony ericsson 300i this is a bad mobile why?
this mobile is hi dont have camera vidou
S.N. Ojha said:
I am very happy with performance of relianceindiacall. It has superior connectivity clear sound and cheap.
marla said:
i agree. she's a little too cocky and "unreal" to be sitting there. i think letterman handled her well though.
hai . i am karthik,resident of india. i have been trying to create a gmail account since 2 months and i do not know how to do this.if possible please send me a invitation .
i don't know, but whatever u said is a "BIG BLUNDER". I m using the reliance phone for last two years. But never got a complaint like that. If fact my all frnds use relaince & we use to give a lot of miss call to other's, but never been charged. Also, there is a misconception about their billing. the mobile only shows the time u start ringing, but actually charged when the receiver picks the phone.
After a lot of experience with other networks, i found it best in all respect. Whether its about call charges, availability, new scheme's etc. u can't get unlimited SMS from same network to network in Just Rs. 50/- per month. even u can make unlimited local calls to any rim number with in a circle & in just 80 paise/min to other networks with a monthly coupoun of Rs. 440/-.
may be possibly ur mobile was dubbed by someone else or may be illegaly used by someone in your absence.
tarun kumar - 09350080485 (All relaince user's are welcome to be "SMSfriend")
rams said:
Hi!
Is there any facilty to send SMS to tataindicom walky set in AP ..if so what is the format i need to type ..
for eg to airtel customer in AP.
mobileno@airtelap.com
Thanks
Rams..
suman said:
dear sir / madam
plz tell me regarding the sending message pc to airtel mobile phone.i mean to say that what the aadress of the airtel site which provide the sma service pc to airtel mobile phone.
Suresh said:
Hi guys,
I am also having some bad experience with spaceforhost.com , For the first time I host my site with spaceforhost.com (only because their price are so cheap, and I didnt update the nameserver records to them, because I want to test their quality) and for the first 1 week, the server load was normal. After 1 week, they suspend my account, I have send many support tickets, but no response. Then I chat with them via yahoo messenger and they told me that they will unsuspend only if I point the nameservers of my domain with them. Their support team are really fools and having no standard. I asked via chat for atleast 2 weeks and atlast they unsuspended my account. I am a freelancer and I stored many of my projects on their server. One day, I tried to log in to my account, but I couldn't. I have send many support tickets again, NO RESPONSE. Again, I approached them via yahoo chat, they said simply "datas gone". I asked the reason, but no response.I asked them to retreive the datas from their backup, their reply was "no backup". I lose $800 by that incidence. It is better to save our datas to a broken harddisk than save to their servers.
I request you all the people, please dont host or register your website with spaceforhost.com They have the worst support in the world.Beleive me!!!
Spaceforhost did it again! A couple of weeks back, our site went down. I chatted with them and the customer support was really rude. They told me that they would activate the account. I waited for a couple of days and nothing happened. Finally, I decided I had enough and I shifted our website to another server. I had learnt from my previous experiences and used the backup I had taken a couple of days back.
Bottomline: Take backups regularly. I take backups at least once every week or every two weeks.
Yeah, SpaceForHost sucks - big time!
- Bobby
Mini said:
Hi,
Check whether your internal microphone is working, ie., you don't need to attach an external mike to record sound or for voice chat.
We bought the same system and there is no internal microphone in that. and decide whether you are still happy with that
carthik said:
hai bobby.i am carthik .i too want to create a gmail account which most of my friends have already done .please kindly help me.
sara said:
i have error 999 sometimes when wanna go in yahoo games,..what shall i do?
She was too artificial and made up. She has forgotten herself on the way up and she should try and quit the madeup accent.
dolphin said:
how I can send sms to MTNL mobile in delhi. The mtnl site also gives a service to send sms but it is not reliable. as the msg does not reach all the times. if i can tell any website which can send FREE sms to MTNL(delhi).
Thanks
Rameez said:
Hi Guyz. I am trying to send a free SMS to this number, 9327489118. It is in Gujarat, Baroda and its a reliance phone. I tried each and every possible thing but I cant do it.
And I am just confused about one thing. That, 93xxxxx@ri.irisme.net ..........WAT IS THAT??? so can I send it from Yahoo Mail? can I just put the mobile number and send it?? Is it going to work?? Please please please HELP ME here someone... I would really really appreaciate you guyz. A friend in need is a friend in DEED guyz. Please help... Thank You very much....
- - - Rameez...
Meg said:
How can I send an SMS to a 922 mobile number in India from USA? Also is a 922...number a TATA Indicom number? Thank you!
Sanket said:
hey guys,
plz tel me vat r the ids for sending sms to orange , airtel , Reliance (in mumbai) through my email accts.
plz the only id i no is of BPL , its ur MObileNo@bplmobile.com (that 2 4 mumbai).
plz let me no , even u can send me mail also.
Hi bobby,
Hope u r doing good. I once dropped a comment in ur homepage long time back... I have a Toshiba portege R150, looks much better than a viao but i have a very bad post purchase dissonance. I overpaid for the features i guess.. It's centrino is only 1 Ghz with 256 MB ram and no blue tooth or even a firewire so i couldn't connect a handycam to it.
ian said:
i keep gettin this error 999 message when trying to access yahoo pool, help please!?!?!?
my name is "lucki rj" i'am a telecom engg, i wood like to address about sending sms to reliance phone from a yahoo messenger.
but notes: Sms can be send to Reliance India Mobile which is CDMA based network all over india, after the sms which u receive from yahoo! messenger ensure u replay it back ofter 3 message, if not u can not send sms are receive sms from the messenger to the perticular number, Download the new version of yahoo! messenger from http://download.yahoo.com/ so that u can send and receive sms any point of time,
if this information is useful plz replay me back with your feedback on my e-mail id lucki.rj@gmail.com
Reliance to Reliance charges aapke tariff per depend karta hai. Na hi aapne ye bataya ki aapka mobile hai ya fixed line ya WLL aur na hi aapne apna tariff bataya aur na hi aapne ye bataya ki aap jis Reliance phone per baat karna chahti ho vo mobile hai ya fixed line ya WLL aur na hi ye bataya ki aap STD karna chahti ho ya local.
So how can i help u.
Lekin phir bhi mai aapko reliance ki site bata raha hoon jisse aap tariff check kar sakti hain.
USE REDIFF BOL MESSENGER SERVICE FOR SENDING MESSAGES TO RELIANCE INDIA MOBILE AND RELIANCE INDIA PHONES ... TRY NOW !!!
YOUR RESPONSE IS WELCOMED..
PLEASE UPDATE ME ON nasmal@gmail.com
adil said:
heloo sir h r u my hotmail account is 2 MB n want to increase my account 250 MB tell me wat is the procedure to increase it
Equebal Ahmad said:
First flight courier making people fool. I sent document
through first flight on 10-oct-2005 from Margao (Goa) to
Patna (Bihar). they told that courier will deliver on
12-Oct-2005.It was very improtant document for me.But
they delivered it on 16th October.
I called all offices/call center of first flight but
they are very irresponsible.No body was telling why
courier is yet not delivered while it is shipped from
mumabi on 11th-oct-05.
Later, on 13th oct on online tracking i get status
"Shipped from Kolkata". Then i called to patna office
and they told person who come with courier miss the
Train.And then i come to know how first flight are
making people fool.
They are sending shipment by train from mumabai to
kolkata and then patna by train.And Charged for air.
How they told me that they will deliver it on 12th oct.?
First flight is charging Rs.70 for this. Other couriers
charge only Rs.30 and deliver within 4-5 days.
so my suggestion "DON'T USE FIRST FLIGHT SPECIALLY FOR
BIHAR AND NORTH EAST"
heema said:
hi all i have read all the comments posted here.bobby u have done a gr8 job.all those who wanna send sms to reliance try this site.it works www.sms.urspider.com
leland sullivan said:
Hi, Which would think is the best Dell inspiron 700 or Apple 12.1" G4 superdrive.
Thanks
Leland Sullivan
Vijay said:
Smsjunction.com is a good sms site but.. i was able to send to 93..... once or twice...? will any one will try out in other states ,,except kerala?
lucki.rj said:
hi all,
as i under stand that u people wanted to send free sms to all over INDIA & US, just login to http://indiatimes.chikka.com/ and register it ,
its free and u get 30sms free every day , u can send sms from online but u can use ur mobile number as a user id so that it will display the same on cellphone......
if this information is useful plz replay me back with your feedback on my e-mail id lucki.rj@gmail.com
That was quick and smart :). You are almost correct. It is a USPS package. Nothing special about the package - just a book I ordered from half.com. Felt like putting in the number and see if anybody else figured it out :)
hai, iam dinesh vydya , i want to send text sms to andhrapradesh mobile numbers, like, 9346xxxxxx, so how can i send through my mail address, can i need to put 91 before the number or not , and sugggest me a mail address,and how can i send ?
thainking U
dinesh vydya
Greg said:
It is an interesting thing. Create a new text message on your mobile with dictionary hinting on. Press all the above 16 digits sequentially from left to right... you will get the message :-)
I stumbled across this post while trying to search for an answer for a problem that I am having with MT 3.2.
I'll create a new entry, and then sometimes when I go to save it, I will get a 500 Server Error while rebuilding the page or site. Sometimes it's fine, and others it isn't. If I delete a couple recent posts, I can get it to start working again. Obviously a terrible way to continue doing things.
Problem is that my ISP doesn't give their customers any error logging. :(
I also noticed the file permissions being 666, as you had mentioned. I changed them all to either 755 or 644 respectively, and was able to rebuild the site, but then the same problem occurred.
Would you be able to provide more info as to what the problem was and how you resolved it (and if you think we have the same problem).
Cheers,
Greg
Katie said:
Great blog, thank-you.
I can't wait to get vista, I see there are some trail versions or something floating around but I will wait until it is officially released.
I found a set of icons also, which should be good to use.
Keep up the great blog Bobby!
Anand said:
Reliance was good upto a point. They charged me a single call of 30000 secs once. I disputed it and after 15 phone calls and 10 emails, nothing has happened.
I call them and the usual answers I get are these:
1) Our systems are being upgraded. I can't see your details.
2) My supervisor is busy.
Reliance is a ripoff.
Jassi said:
Hi, is any way to send sms to abroad through web> Plz let me know?
Karam said:
want an invite i have 17
ravikanth said:
Sir,
How can I get a list of incoming and outgoing calls of my tata indicom cell phone.
I accidently deleted a call from my recent call list.It is the call around 02:00 am, 4 or 5 days back.my phone number is 9247110049.
can u give that phone number or list of incoming and outgoing calls during this week.
Speedy said:
Can I send SMS to dubai for free?
tridip said:
try spicesms.com
Tim Wilborn said:
Hello from Kerrville, Texas. I am a musician (organist) and artist (stained glass) and am over awed by the Leonard Bridge Project. It has inspired me to write a drama with music about cultural bridges. I was just about to give up being inspired by anything until I read the article in the Wall Street Journal. Tim Wilborn
Raymond said:
hey, do you have any George Davidson full mp3 song ? Why just "L For Love" and "Mariage d'Amour" ? More please !
archana said:
Can we send free SMS through PC on airtell & reliance mobille
If yes, can anyone please pass me the link.
ARchana
Nasir said:
Hi all...i am Nasir...u can send limited sms to the RELIANCE mob..download rediff messenger...in that u can send msg to all inidan mob...u can send 3 sms without recving the reply(per day i guess)if u get thier reply again u are able to send three more..acording to me this is the only reliable service..to reliance phone..soo enjoy it..
haa if u want to send more sms...create many ids!!!
if u found this gud..plzz reply to my id..chatbtv@yahoo.com or nashbtv@yahoo.com
i have a reliance delhi mobile n0 9312212900
is there any one in the world to tell me how to send sms using my pc
Arun said:
Pl exp me how to send free sms to Reliance India Mobile of MP State from internet
Thanks
Julia said:
YASH said:
hi i lost my cell in april at that time i got some calls from number 09830438108. but now this number does not exist. How i can get address of the owner at that time
samson said:
hi i want to increase my yahoo stotage bytes capacity already 1 GB is dilled i want to increase my free one more GB.
ashraf said:
Hi!
I want to know that how can we send sms or mms through pc to any mobile or a land line phones of reliance, Tata indicom & Walky. Plz tell me.
Asrf
MUTHU said:
IF ANYONE KNOWS HOW TO SEND SMS TO RELIANCE MOBILE FROM MALAYSIA.PLEASE SEND MAIL
Lisa Markowitz said:
Reliance India is definitely the most reliable and convenient way to call India. I wish it was a little bit cheaper for calls to cell phones (it is 12.9 cents per minute). But more importantly, they need to signal the caller that their money is running out. At the moment, the line just gets cut and that is that...no warning whatsoever. It's so strange because in every other way, Reliance India is so hip, modern and together...the website is well designed too...but no warning signal!!!!!! I really like the way you can view your call record, which displays each call's cost and length (which i wish was shown in minutes instead of seconds). Overall it is an excellent service and I am glad I found it since I call India approx. 3x per day!
daman said:
Can we send free SMS through PC on airtell & reliance mobille
If yes, can anyone please pass me the link.
daman
vivs said:
Reliance India Calling card is good, but the service sucks when you land in some problem. Some days back I was wrongly charged.
The its been days now they havent yet refunded the money to my account. 1st call they promised me that it will be done in 48hrs, then after 48hrs i called again they promised me 24hrs, after 24hrs i called again they are now not in a position to give me the turnaround time. When told that I want to talk to the supervisor, I was not connected to the supervisor too. My supervisor is busy, this is the anwser I get when asked for the supervisor.
I doubt if Reliance has appointed any supervisors.
The RELIANCE CUSTOMER SERVICE SUCKS.
Sam said:
Regarding sending sms to India. do you have to add 011 in front of your 91?
Ankit Khasgiwale said:
Hi, u can send free sms to Reliance india mobile from http://atrochatro.com the limitation is u can send only 1 sms per day.
And as posted by Nasir u can send 3 sms to almost ne mobile from rediffbol messenger...
Njoy...
well, i see all of above messages. but i want to tell you that, we can not send any sms to mobile by using email . so there is no need to try using this type of fool work.
i have a idea " please use "Reliance Sms Topup card" only rate 55/-
regards:
It will take less than a minute to sign up and you'll be
sending lots of anonymous, prank, fun and SECRET SMS messages to any phone in the
world in no time! http://sendfreesms.mcommunity.biz/
Ashwani Kumar said:
PLZ tell me the smpt server name of airtel gprs network.
Hi ppl... I stay in Dubai..I wud like 2 send sms to my friend back in calcutta.He has a hutch sim card.The probs that none of the sites like krifysms or any site as such doesnt have this system of recieving my sms..Can U help me out n lemme know a solution to my prob..
she looks like that girl who plays Dawn in the TV show Buffy... But that is my best guess.
ayaz said:
can anyone plzzzzzzzzzzz tel me how can we send unlimited fre sms in maharashtra to mtnl , tata ,orange , airtel network if u know can u plzz let me know
I am contacting you on behalf of Union Vector Technologies Sdn Bhn, located in Kuala Lumpur Malaysia, with offices in Singapore and Sydney Australia. I would like to present you our 2006 Offer for our stable and economy-class Bulk SMS coverage
What sets us apart from the rest of the aggregators is our excellent and dedicated support via 3 support centers located in Asia and Europe - online close to 22 hours a day, every day and attending to your every need.
We provide connections to various routes with full-feature support such as Numeric and AlphaNumeric originator, Delivery Receipts, Unicode, Binary, WAP OTA support.
NEW: For bulk SMS to European countries such as Germany, UK, France, Spain, Portugal we have at the moment special routes on offer which might not have full feature support but provide for a very fast delivery and good throughput for your IVR, Premium SMS or WAP Push campaigns.
Test accounts for all routes are available free of charge.
Please email me with any pricing and support requirements. If you would like to find out more information on our company and services offered, please refer to our company website at http://www.uvsms.com .
We look forward to talking to you and finding a solution for good business with your company.
Regards,
Keagan Pottas
unionVector
Technologies SDN BHD
MSN: uvsms_sa@hotmail.com
Toby Joseph said:
use DTDC? NEVER USE DTDC! I had asked for a package delivery from Cochin to Chennai. I gave my package to DTDC on Friday and it was delivered on Monday, but apparently the DTDC guys never entered it into the tracking system. And assuming my package was lost, I made numerous calls and visits to DTDC regional office in Cochin, and spent a huge sum on STD calls to their head office in Bangalore. The Bangalore head office told me on Thursday that the package has been lost, please make a complaint to Cochin regional office. All this after the package had been delivered on Monday! DTDC may have the largest network in India, but this speaks volumes about their inefficiency.
pavani said:
i want to send free sms to dubai and hte number is 00971505061254 , mine is relaince phone....but i wnat to send sms with free of cost ...is there any possibility of doing that
eddie said:
i am satisfied with the services provided by reliance india but i want to suggess u not to make reliance to reliance free calling card complete here continue it.most of the peoples like it.
so kindly take care of this.
eddie sandeep shilpi etc
now on windows machine with TCL installed, just double click the file. on Unix/Linux machine just do this at prompt "wish SMSsender.tcl"
you are set to send SMS for free.
If you want an self executable (no need of installation) reach me at hellokrishna@yahoo.com
-RadhaKrishna
Chou said:
The most unreliable service
I sent a box of chocolates to the CEO of a company (one of my clients)
I had to declare it at the courier office, which I did - bad mistake. It just makes your package stand out from the rest.
The person got 3 pieces out of a total of 12 chocolates.
They reopened the contents and after helping themselves to more than a few, resealed. And since I had already opened it once, doesnt make a difference if it gets opened a thousand times later.
The most embarrasing time I had when the CEO made a light hearted comment a few days later. I did have to face a lot of embarassing moments. If it wasn't for the good relations I share with that company I might have just lost a big account.
One word - Never use First Flight
hitesh said:
hi..
i am trying to send an SMS to a mobile phone in dubai.. the number starts as (+97150 *******)
is there any website tht can let me send sms free of cost.
thnx
bhoraki said:
where can i find the hutch phones owner address.
suresh said:
really it is good and thanx alot
Toby Joseph said:
I used First Flight for a package delivery from Cochin to Chennai. I gave to the local First Flight Office on Thursday Jan 12, 2006 at around 10:30 in the morning and it was delivered at 10:30 on Monday January 16, 2006. I dont have any complaints against First Flight.
Prabhu said:
Hii, I saw a new site bulksmsindia.co.in wonder whats it all about
Sachin Patil said:
Gr8 man!!!
Thanks for such a wonderful link.
Sreelesh said:
I have almost tried all the couriers in India and burnt my fingers many time. I can with conviction tell you that first flight is the best, both for air and surface cargo. it collects at 7 pm in the evening and reaches before 11 am to the addresse in most of big cities where there is direct air connections.
Soti here, Hey suppose I want to read from a database then output to form elements so that the user can edit. How do I go about this?
Cheers
Reply from Bobby (1/28/2006): Soti, If you are talking about a MySQL database with a PHP frontend, you can try this link: http://www.awtrey.com/tutorials/dbeweb/ .It's a short but good tutorial.
Rakesh Sougaijam said:
good collections and hard work. I hope the blog shall be very informative and serve its purpose. Also hope that we can togather make manipur shine in the world
We have 3,000 customers.We must sent daily 40 to 50 SMS for each customer about the market servey. We are requiring bulk sms software with out modem which was sent by computer internet to all GSM & CDMA mobiles,and also sent maximum sms per one second or short time. Have you possible to arrenge this type of bulk sms server software? Can we sent the sms to 3000 mobiles (both GSM & CDMA mobiles) by only one single click ? If it is possible reply us, with the complete full details of requirements for above and also with your server software price.............MOHANA RAO
PLZ. TELL ME HOW CAN I SEND FREE SMS TO TATA WALKY(033-5526-****) FROM PC....
Beatrice Nkrumah said:
Hello, i have a problem with my yahoo account and when i enter the id and password it open but the reply can't open and it keep on saying yahoo 999 error and i don't understnad so i want you to explain everything to me okay.
bye.
Beatrice
sriraj said:
Hi ,this is for those who wish to sms to reliance and other mobile service providers try using the yahoo messenger sms service that works really well except for bsnl mobile phones for that use www.kathiyavad.com if any problem mail me
There is a free SMS sender tool available at my home page http://www.geocities.com/hellokrishna/opensource.htm As this is written in TCL, you can see the code, tailor to your needs. Pl send me your feedback and feature addition requests.
ravi said:
hey all, u can send sms free from www.chikka.com, just u download web mobile in ur PC from www.chikka.com and send sms to anywhere in world. u can also receive msg on this web mobile. reply me if u r enjoying this.
Anuj said:
Bobs,
How was your Valentine's Day? Long time since we talked. Will give u a call sometime.
Rajiv Soni said:
Hey All,
Good News to Send sms to any mobile (Inclusding reliance)use rediff Bol >> Sit back and relax >>
u can send only three sms from a account if the limit goes upto 3 try sending after 24 Hrs from the same account, IT WORKS.
SO ENJOY..............
DONT WASTE YOUR MONEY BY SMSing FROM YOUR CELL
Jenny said:
I have not seen the movie, but it does seem remarkably similiar to the bank robbery in England. It would not be the first time criminals have copied a movie.
vismay said:
Hey guys I got a great site to send free sms to any reliance CDMA and also other mobile no......the problem is u can send only one message per day to a no. And maximum of two messages per day to any no
The site is- www.atrochatro.com
It is a very good site
Plzzzzzz temme if you like it and post your feed back at my email id
Thanx a lot guys
jpcansa said:
and how to remove a new line in all the cells of a entore column?
sachin said:
hello readers just i want to know can any one help to me to make a free sms in u.a.e from website. so please any one help me
if any one know than please send me email on sachinp0@yahoo.com
thank's.
Kevin said:
What was that song that was featured on the last episode of friends? I think it was an Irish band.
NIDHIN said:
How I can send free sms to reliance & tataindicom mobiles
Hello friends,good to see this blog buzzed up with so many enquiries.Anyways,I came across www.jajah.com wherein you can call any mobile/landline in the world for free(5 mins. they say,but my sis spoke to me for 15 mins. from Dubai).I also found www.atrochatro.com from where you can sms all the mobiles in India(including reliance,bsnl,tata indicom,...).I personally checked it to my own mobile!!I have started a blog for smartphone users from India and world(htc typhoon) which consists of exclusive content which is a result of my research.Check it out @ http://windows-smartphones.blogspot.com
Thanks Bobby for giving me this oppurtunity!!You influenced me into webdesigning!!I came up with http://aspspider.net/dotnethunk Rate me yaar!!
Anuj said:
www.sony.com
Fakhruddin said:
Hi,
I am fakhruddin from Dubai , I tried reliance mobile no 9352505247 in Udaipur for sms through 9352505247@ri.irisme.net but it failed.
I am making any mistake here, please advice me.
f_alamshah@yahoo.com
manjarita said:
www.intel.com
Gary Harper said:
I seriously doubt the monitor is your problem. If video related at all, those problems would be due to your video card.
Hi all, i was looking 4 the same answers u all are looking 4... "how to send free SMS from computer to india reliance mobile"... I found the answer and it is so simple and most importantly IT REALLY WORKS!! This is what u all need to do... just install yahoo messanger... and send text messages on any mobile (even Reliance) with +9193########... n it really works... u can send 3 messages max without getting any reply back, but if you do get reply back, u can send 3 more... on every reply, u can send 3 txtmsgs..n so on. who wants to keep sending msgs if you are not getting any reply back anyway!!! So friends, try this n cheers to success and stop looking for more answers.... cuz i wasted sooo much of my time too. This is totally FREE for the sender... 9193########@ri.irisme.net also work but u are probably paying for outgoing smss. Remember, if i can do it, so can u!! Good luck...
dharmi said:
fakhruddin, make a correction on your address....
it should be 919352505247@ri.irisme.net and this should work, i always send sms just like this to my rel friends in india.. it works!
sankar said:
Hi !
You can try out this network monitoring s/w as well - free trial version for 30 days
Be catution with relianceindiacall.com they may over charg your credit card as they did with me and i am following with them nothing happening alway i got the same reply that we are looking into your problemgive us 24 more hrs
good serivce ..afterall indian company . let us encourage ..by submitting all defects related to thier service . but over all it is good .
keep going Reliance . if you could reduce by 10 cents , still it would very appreciable bcoz it will match with outsdie other card service companies ..with quality ... what do you say Ambani kins.
Thanks for the pointer to such useful information. Stumbling across your blog has been really useful. I had no clue about COAI earlier.
-Prakash.
Amal said:
I have just tried First Flight for an Internaitonal shipment to Gandhidham, Gujarat. The documents originate from Muscat. I was promised 3 days, but today it is 8 days and still no trace of my package. Tried calling their office in Muscat. The lady at the counter confirms that their internet tracking is unreliable. She refuses to believe that my envelope has not been delivered!! I have spent more money in calling my contact in India to check whether it has reached, than I paid for the courier itself!! I was told a lie that the India office is closed so they cant check the status of the delivery. In fac, hte office is very much open and has no idea about the parcel.
I am praying that it reaches. Otherwise I will stand to be put to huge inconvenience!
Had I read this blog earlier, I would never have chosen First Flight!
PLEASE PUT THIS BLOG UP PROMINENTLY SO THAT PEOPLE LIKE ME DO NOT HAVE OT SUFFER AT THE HANDS OF SUCH COURIER SERVICES!
pooja said:
my no.is 9324762851 i have done my cell phone postpaid before 10 days and my brother he took my cell phone with him for picnic iin goa now can u give me the list of all number which i lost recived , missed , and dailled and sms number which i recived and send plz help me out.
pooja said:
i want missed and recived number on my cell no 9324762851 can give me the details of tahts number
Elangovan said:
i wanna send sms to reliance through PC. is there any website provides free service? !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
reply me
urs
ever
Elan
Elangovan said:
My number is 9360672835
I hav tried to send sms through net. but i'm still trying. Is there any one to stop this searching
urs
elan
Joe said:
A simple post that can save a lot of work. Goood Post Bobby. Thanks.
dear friend
finding these info was just exciting..
i'm happy to death..cause i didn't have these songs unfortunately..
I've been grown up with clayderman's songs,I've been dreaming about being someone like him for 10 days..he's my Icon and it makes me fly to see others like me..hehe..
thanks anyway..
do you know where i can find the notes of these songs so that i can play them myself?
Pradeep Kumar said:
How I will search aparticular phone no. through web
i,ve changed my mobile from idea to reliance, bocz i found it was worth and more beneficial. but when i am delevering sms from Dubai, my Lf.companion iz not receiving, why? i am very sad to hold such company who cannot provide sms from foriegn countries to home town. can you suggest me any way to access the service? Mr. Das
from Dubai# cell#+97150-3728241
THNKZ
khooban said:
i have need of 250MB space plz ii am very thankful to u. if u give me a big space of mail box ii need of it
i very thankful to u.
khooban ayan
will said:
My name is Will and I am doing a power point presentation and I was wondering if I could use some pictures from your cite. The picture will only be used once at my school and will not be used otherwise. I will be sure to cite your page in my bibliography. Please let me know if this is okay.
Thank you,
Blake Bibat
Hi everybody want to know some secrets of airtel then visit my site i can tell you how to watch live television on ur mobile sets and computers free sms application download them from my site and enjoy sending sms to any part of world for free it work 100% so what u are waiting for just visit my site narendra.Kumar.Mcommunity.biz if know more secrets about airtel then mail me jajga_ranchi_dps@yahoo.com
I m using Reliance since more than a year & I compleatly satishfied with the service ...they should reduce their price a lil or they should offer flat calling rate for one months for one perticualr number
s.mariappan said:
I am mariappan from Palani
Jenny said:
Congratulations!!
abhishek said:
wanted to knw..is there any company offering smses[not free] to tata indicom walky. i have a website and am using cellebrum to send smses to users..but it works only for cdma/gsm cellphones, no landlines are supported.
pls tell me..is it possible to send sms to walky connections thru an sms gateway.
btw except for the landline thing cellebrum rocks...just 45p per sms, and 50 free sms on reg.
In general First Flight is comparatively ok to others. They have got a system in place. Some areas some people make errors. I know some of you have suffered, do we have any system (law) to make claims and punish the offenders? That is a big question. Past is past, what about future? How to make fast claims? Its better we focus our discussion towards solutions now.
If you are that much serious you might have gone with some dedicated servers or something. What all things you are expected to do with these pea nuts amount (~400 bugs)? Simply making baseless allegations against our company.
Mr jinson karedath, We are supposed to provide only hosing not correcting your program. we have informed you before itself that the problem was with your include. If you don't know programming don't blame us.------------Mr SKJ,We notified you many times regarding the virus affected files uploaded on your space. We were forced to delete that. Still you are blaming us?------Mr Suresh,
Your account was deleted because of non payment of your dues within the specified time limit. It is not our fault.
salim said:
when i reciev message it came like that !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! and anther font no english can you solving the error
almas said:
how can i make an id in Gmail.com
plz tell me as soon as possible
could u plz send a Gmail invitation
thank u
sufia said:
I am in great need of Gmail.Send me an invitation for creating a Gmail id at faaiz_sufia@yahoo.com.
the pleasure will be all mine.
Tammy said:
I guess it works for Windows, but how about when using an eMac? This would help a bunch!
i found a better option with www.pingo.com/fathersday.do thats offering a promotion till june 20th for $10 in free call when you sign up. so thats 40% off there 11.5 cent rates.
Thanks a lot for the information. It is very useful.
abhishek said:
Hey Bobby:
I have been looking fror this since a long time....thanks,,
AP
amit sengupta said:
its gr8 yaar thanks
R. Shivaraj kumar said:
how download Kannada movie ringtones to Rilience Mobile
Debashis said:
I have been using the service for more than 2 yrs i beleive. And I am very very satisfied. there has been glitches onece in a while ... but come on folks (the whiners)... what in this world is 100% successful error free? Ask Mr. gates... didn't his launching of win95 (or win98)
failed too!! So we should all be happy with what we are grtting from RelinaceIndaicall...:)
Avinash said:
Liked this one on Aamir - clairbuoyant.blogspot.com
please give me all commands whic ever we use in plesk
Ravi said:
The biggest problem with Reliance India call is their customer support attitude. They never agree to refund the money for non connected calls. I was having below 1min calls and there was an immediately the same number in next min was called still they dont agree it as their side problem.
I prefer to use global telelinks or necc wireless both give good quality and price wise much lower than reliance.
I suggest please please donot use reliance and they should know how important the customer support.
I thought it was just me having problems, as I am not all that "web site" savvy. And thought I may be asking silly questions, that they decided to ignore me?
MY advice also..... As my site has been down for over twelve months now.............. Leave Spaceforhost.com alone.........
If anyone can offer any help whatsoever, my e mail address is nigelwalford2002@yahoo.co.uk
I remember that like it was yesterday! I cant wait til this season kicks off. I have tickets to the Florida game and im so excited to see the gators go down!!!!. GO VOLS!!!!!
For those people who think that their consignments are delayed by some courier, let me introduce you the WORST courier service in INDIA - one and only DTDC. Three times in my life I have used DTDC, and all the times they had shown their service.
The first time was in August 2000. I sent a courier to Panchkula youth hostel near Chandigarh form chennai, the courier did not reach the place at all. In the mean time I lost my purse along with my courier bill and DD challan. So I was not able to sue them and I lost the money paid for the DD also.
To my fate, we can book courier only using DTDC through our company. I booked a courier to Erode from Bangalore on March. That courier reached the receiver only after 14 days. That too even after a lot of complaints, tracking, STD calls and so on. Cleverly the courier people anticipating the consequences had got the sign from the receiver on the sheet dated 10 days back.
Again, I had sent a courier to GOA from Bangalore on 21st June. It has been a week (today is 28th) and the courier had not reached the receiver. I spend all my time calling, complaining to Bangalore HO, ring road office, Margoa office and writing to customer care. They dont even hear it yaar. Each call goes for around 10 minutes and 3-4 persons get the details and cuts the call finally.
SO my only advise to all the risk -averse people is dont use DTDC even by mistake.
I checked the Clevercalling.com thing, and it is very good as far as price and quality are concerned. But I am sure there are other good offers out there I might don't know about.
suri said:
My parents sent me a parcel containing expensive clothes, dry fruits and sweets through DTDC. When I got it it had big holes on it and the clothes were in a tattered condition and all contents destroyed by rodents.On top of that nobody listened to our complaint seriously
Shantanu Pathak said:
Hi buddy, thanks a lot that you have given such an improtant information. its really important for me...
thanks again
nisheeth said:
I want to send my handycam from nasik to nagpur...which courier should i choose.....i have the option of blue dart and first flight...first flight claim next day delivery with less charge...blue dart asking 800 rs for it and 4 days..are they reliable...
sachin said:
Hi there,
I had this weired issue. I live in Seattle, USA and have T mobile service. I was able to send SMS to any reliance cell phone with my previous Phone Motorola V3 RAZR, but now i changed my cell phone. I bought this new Nokia 6681 from India. Now I am not able to send text messages to any reliance Cell phone. Though I am able to send SMS to any other cell phones like Idea, Airtell and all.
Is there different seetings i need to do in my cell phone. Please Advice.
I sent an important document to UK from Bangalore by DTDC on the 4th of this month and it is supposed to reach UK in 3 working days. I tried phoning the DTDC office and i m informed that the document is still lying in Bangalore. I am unable to track online and i have made numerous phone calls to the office n everytime somebody picks up n says they wud get back to me soon but i never receive any phone calls from them. they themselves r unable to track the document i suppose. whot sort of courier company is this.
i need to claim for a delay in shipping... this is ridiculous n i advice anybody who has plans to use DTDC as against doing it.
it is the worst courier company in the world n they have got such inefficient customer advisors.
if anybody knows how to claim for delay in shipping pls let me know.
I am trying to send sms through internet on following Reliance user in Cochin, Kerala 04843103720 but it doesn't work with this number. Probably this number is changed and please can anyone tell me what is new number?! Also through which site I can send free sms to Kerala Reliance subscriber? Maybe someone know any site where I can find list of Reliance users in Kerala which numbers were changed.
You can mail me anytime at my e-mail: la_afsun@bankerinter.net or laila22540@yahoo.com
Thank you very much
With best regards,
Laila
Lakshman said:
I have been using Reliance for 2 years it has been very good. Unfortunately, the site is down now. I don't have any option to reach their customer service to recharge. The 1-800 number used for making call does not have option to reach their customer support personal.
I think, they should improve the customer support access to avoid my situation. If any one has the 1-800 no. to reach their customer support, please reply to this posting.
Mohit said:
How can i send free sms to Qatar mobiles number start from 00974..
However, I would say that it should be done only when you are ready to allow remote connection; for instance; asking your friend to help solve an issue that s/he knows. Otherwise, it is best left deselected at all time.
Anyway, after recently converting to the Mac, I know I'll never go back to Windows.
Do you have the piano notes for L for Love? If you do could you please send it to me at my email adress bphung2004@gmail.com
Mandira said:
Hi i tried the same but its not working out.
Preet Kumar said:
Reliance India call really sucks as a company. They just setup this website and at the backend they dont have anyone really supporting it. You call them day or night, a gaav vaali picks up the phone and she does'nt know what to do.
I did not logonto the website for a long time and naturally I forgot my pin number, so I clicked on the "Forgot PIN" on the website and tried re-creating the pin which I was supposed to get via e-mail. This never showed up even after 20 tries.
The gaav vaali on the phone does'nt know what to do and Reliance wont take payment over the phone without a "PIN" number and they wont give me a "PIN" over the phone.
To summerize, they disabled my account because I did not make a payment and they wont let me make a payment. I am 100% sure within some time they will be reporting me to the credit beureau for not making a payment when all the time its their stupid support system that really sucks which caused all issues.
PLEASE STOP USING RELIANCE INDIA CALL SYSTEM AND MOVE ONTO SOMETHING GOOD.
if any one need to send sms to any of the network carrier please mail to rahawaj@yahoo.com... i hav a software which can send to any network in india FOR FREE
kinu said:
can v send sms 2 any mobile phones via pc . if yes then pls inform me.
Prasad said:
Thanx alot it really helped me.
Satya said:
I have this strange feeling that the numbers which I use to call India using RelianceIndiaCall has been given away to 3rd party. I just have some people, from India, call my number multiple times to use their service and say their service and call rates are better than Reliance!
Although its connectivity and quality is great as compared to others in the market, their website, the only recharge method I know of, is out of service very frequently. That irritates me.
Suparna said:
I want to send free sms to a bsnl mobile no.starting from 9433..... in Kolkata..But it will be absolutely free and can send more sms.Give me proper idea.
sonia said:
I think she was absolute nonsense in that show, she should be careful on appearing on international media like this. she has gained some popularaty because of miss universe stuff and bollywood, ask her to to keep her silly smile and stupid mouth shut
Help me i want to open Googlemail.com Accounat
Help me.I need
swayam said:
First Flight is the worst.....Some visuals were couriered from Chennai to kolhapur on 14th of Oct. 2006 and today (24th of Oct 2006), after following up for almost a week ,they are saying it hasn't reached its destination coz invoice is not there.....there service is miserable....it is the WORST ....
Samik Dutta said:
It Sucks !!
Reasons below:
1. Cannot connect with valid registration number and pin; from the second time it is saying "Invalid number"
2. Opened another account but same problem again
3. If the call is not connected they charge for that too
I feel very frustrated.
Samik
NK said:
Reliance customer support is extremely unsupportive...
I've been their customer for about 2 years now and I admit that they have a fast connection and quality talk experience. But run into some billing problems and they treat their customers like shit.
I took off a number from my pinless dialing list for a friend (who doesn't know my pin) to register that as his reliance number in June 2006. Ever since that time I've been charged for all the calls from that number. I got to know it late when i checked my bills, and I complained right away. Took them 6 bloody calls over a week to finall be able to TAKE MY COMPLAINT (Geeeez).
After a week they reply, yeah you took of the number as you said in june, still we believe you were charged correctly. I called back and yelled, the supervisor said he personally agrees i shouldn't be charged, but all he could do was to forward my complain to the technical department again!!!
BIG BAG OF BULLSHITT is what is Reliance when it comes to customer service and accepting their faults. I'd use some other service from now on.
Cameron said:
She cant be perfect
so what if she has too much make up
and whats wrong with laughing
Aishwarya Rai is so beautiful inside and out and you should all stop nit picking
hey users
I am back with the solutions of ur problems see if you want free sms to any mobile just apply my simple trick go to rediff.com download rediff bol messenger 8 .just register yourself and open rediff bol and now u are ready to send 2messages to each mobile phone everyday.hey guys if you have airtel live activated on ur mobile just you can send sms.for details contact me on my email id i.e jajga_ranchi_dps@yahoo.com.chikka is also good bye
Roshna said:
Hi
Can any body tell me hw to send free sms to Dubai
Mail me roshna.t@rediffmail.com
The wireless adapater is for my desktop which is in a different room from the router. My laptop does have an internal wireless card and it is working great :)
Your Mac Powerbook looks awesome :). I am sure you love it. I might switch to an Mac later after a couple of years. For now, windows works great for me :)
- Bobby
raghunath rajendran said:
Yep.... good info to have... just one google search brought me to this link...and the link u have pasted is definitely useful... thanks!!!
Dear Friends,
We are SOFTWARE Solution Providers, Content Providers and Buyers And Sellers Of BULK SMS. Directly CONNECTED TO SMSCs & MANY GATEWAYS GLOBALLY and can provide BULK SMS at very competative prices Economy and Premium Routes with Delivery Reports,OTA,WAP,7-8 Bit,Binary Support.
(Prices depends upon destinations and volume purchase,if you have requirements for South East Asia ,Australia, Middle East, Saudi Arabia, EUROPE, UK, Africa, America & Canada or Globally please emails us back for Coverage Area/Prices.)
You set up your own SMSC at your premises.
Virtual SMSC software HTI Gateway V1.16
We also Provide,best proven Mini BULK SMS GATEWAY suitable for portals, web sites, companys who has Bulk SMS business, or want to start.
We have Empowered many SMs based Websites and Portals, directly can connect ot Telco Grade SMSCs.
We can customise our product as per your requirement.
Looking forward to hear form you for our mutual benifits.
What, don't just doing a "Right Click > Clear Search History" on the search field do the job?
sudo said:
I was going to send a parcel by First flight as recommended by someone but when I made a search for it's location I got this page in google...and read the encouraging comments one by one....hence I am opting for something better than First Flight ( may be it's name is Last Flight.
http://smsnjoke.com
A huge collection of SMS, Jokes, Quotes, Oneliners, Shayari, Shayeri, Post your jokes, Post your SMS, SMS to india, Sms to Pakistan, SMS world Wide
Yea.. there is website http://www.smsnjoke.com
From there you send sms to any phone anywhere in the world.
Thanks .
Regards
Ajay.
natalie said:
i thought she was ALRIGHT
except for the extrmely fake accent occasionally.
you could sense that she was definately nervous which is why she laughed for no reason all the time.SHe should just be her natural indian self instead of turning into a compulsive western wannabe.
nikita said:
hi bobby can u tell me your email id i need to have some information from you .mail here nnikita12@rediffmail.com
Ray said:
This was annoying me so much...THANK YOU!
john said:
looking to get a gmail acc,
can anyone recommend and help
anand sharma said:
when i get my new postpaid connection inspite of prepaid connection my application number is 2314171326.
Sivakumar Ganesan said:
Suppose you want to make conference calls (2 person in india) You cannot do that from reliance. This sucks big time and also *67 (block your number) does not work with reliance.
Malini Sharma said:
I think that all of you guys above have gone bonkers. First Flight is the best courier U have ever come across. Don't blame them for nuts.
How to go about moving the file.. mv does not work
with mv -apv ....
robin said:
bull shite man were is ur bangalore branch
Emily said:
I have fallen in love with George Davidson's piano music & am searching for sheet music to his versions of Starry Starry Night, Unchained Melody, Norwegian Wood, all the covers. Is there any way to find these????
I tried calling their customer service 3 times today and was on hold for more than 15 minutes!
Though I like their connection, they are very expensive. I went Alltel and got fantastic price.
Guri Singh said:
Reliance India Call is great when all is well.
There have one of the worst websites made, I am amazed at how much progress India has made and then I see a poor website like RelianceIndiaCall. I cannot update profile in any browser. I cannot send a contact us email.
The customer support, well I could not get to them EVER. I have spent 4 hours of my life at various times being on hold only to weigh in on the amount of money I have spent on just waiting.
I am actively looking for another service and just might jump to Skype if I cannot find a good replacement.
Reliance India in one word: SUCKS
Don't bother using it unless you have no choice.
Reliance India People> Email me if you think my comments are unfair, I will pinpoint problems with your website, but I will charge you ;-)
friends said:
Hey !!
do u know the best of google.??
no ??
v have frnds here.
wow !!
isn't it gr8.
Tatsa said:
Thanks for the pointer to such useful information. Stumbling across your blog has been really useful. I had no clue about COAI earlier.
Thank you Very much
ali said:
Utterly non-sense. Her embarrasing smile, silly open mouth laughter, giggling, mocking n jeering of the audience was so shocking that it shattered the artificial beauty n intelligence of aishwariya down to nothing.
My point is, this is the proof that she does false n artificial SHOW OFF of her beauty n intelligence in INDIA.
If you don't trust me, go n watch the clip yourself.
wow........ nice links buddis thanks a lot..
i got couple of missed calls today, i wanted to locate them, i've been searching very seriously giving many different querries in google at last i found pointers here, gud work buddies.., keep it up,byee
tom said:
Agreed, the govt is taking advantage of this postiion and has implemented 'a computer for every student' policy. Analysts advise the govt has tendered a project to purchase 150,000 computers by first quarter 2007. The country already has a small group of technically savvy people - movie scenes have been produced by Macedonian IT personnel for various Hollywood films (the larget being The Aviator). Good on them, they may compete with India one day (obvsiously to a lesser extent). USA and China have been an instrumental driving force, lending expertise.
Joel said:
I have the same problem - EXCEPT that when I follow the directions you gave (which I've known about and tried, yet again) -- I experienced the following:
1. There was NO "EML" file type, so I created it.
2. Then there was no "advanced" option, so I selected "Restore" and followed the direction on MS's page.
3. I try to open a saved .eml file from my desk top and all it does it open my Outlook Express and NOT the email itself.
When I return to the FileType tab - the EML reference is GONE!!
HELP! This is quite annoying.
RICHARD DIAS said:
First flight couriers should be awarded with the top most couriers in delayed/unsatisfactory-poor service category.
They seem to play with public’s important documents and do not realize the importance of delivering on time or at least in providing good/prompt feedback.
thank you so much....i had nightmares not knowing what to do because i have kids and there are some adult topics on pregnancy that i did not want them to read.
thank you for keeping it so simple for those of us who are not tech savvy.
Raju said:
First Flight know nothing about pincodes. I had a courier 1 month back and its still not delivered. If i check it online it says address insufficient. Posts sent to the same address through normal postal services reach me correctly and within a few days but. If i call them nobody lifts it. Great service...
Suresh said:
Life saving..
Thanks a ton..
renish said:
hay...its nice....working..but somenew series r not included...4 Eg:-in kerala there is 9946 series in hutch..i cannot find that in here...
Gustav said:
You guys are paying for something which you should not pay. Go to www.fonemine.com and try the service. No charge for making international calls to about 30 countries (india included). You get to hear an ad for 15-20 sec and then you get connected to the party (they need to hear an ad to0). I guess you get the point of why they are offering this. Try it. Looks good. Also, they have lot of other stuff since it does not look like that they are a phone company. Looks more like a mobile company doing things for your phones and getting rid of the need to have computers to do anything
Tex said:
well..as far as i know..on mac, hold down Option with either ctrl or apple key and then press the enter..you should get the same thing..
sir i wann. free sms in hutch mobile
sayri , joks , jobs, news, sport
shreekant said:
I am really angry about First Flight services. My Pan card is despatched 13th Mar 2007, but today date is 28th Mar 2007, still i not get my Pan card and not even a call also.
So plz kindly do the needful.
I called some people but they are not responding to my questions...
Lila said:
I've always wanted to know how to do that! How perfect!
Rahul said:
First flight is really making fool to people..
My parent sent me a photo frame costing 4500 by First flight courier.When i opened that it was empty n now they are saying that they are not responsible for it...
V. Chawda said:
If you want free sms no your Reliance CDMA thn u can do the following:
1. Open one Hotmail email account.
2. Go to Msn Messenger or Msn Mobile thru website.
3. Register your Reliance no. on your Msn Mobile and activate it.
4. Once activated, people can send free sms to you (all they need to do is right click your name on Msn Messenger and choose the option "Send message to Mobile Device")
** And yeah it is free for Reliance nos. so need not worry
how to send the sms through rediff to the mobile out of andhrapradesh but in india
vivek said:
it's cool and very helpful for everyone
Zainab said:
Hi Amir Khan i am Zainab...I wana talk to u..i like ur acting ur dansing....plzzzzzz reply me...
nilesh said:
wonderfull this is very good link it helped me in many ways.
Thanks dear
vinayrajnish said:
hey ..cool man! this is great blog... it's giving such a useful information
hats off u.....keep blogging such useful things
keep it up.
arpana said:
First flight couriers r the worst couriers i have ever come across.I sent a consignment on 30th april and they said it will be delivered in 48hrs.Today is 4th march and no news of where my consignment is.I would not suggest anybody to use this courier service.
Hello all
i am frightened with all ur replies since im planning to host a site with spaceforhost.com.Already bought domain name..but ...?
mathew koruth thomas said:
its wonderful.my best wishes for this web.may god help all the members of this family.
andy said:
Man you should have said something to me. I would have at least smiled for you. I just google-searched UT Vols and there I am. I have so many great pictures from that day as well, and WHAT A GAME! Let's get em back in the Swamp this year! GO VOLS!
mann said:
cool man...cool, thx a lot
snehal said:
i wasted my 2 Hrs here..i think there is no website which allows unlimited free sms to cdma networks...if anyone knw how to send unlimited free sms frm GPRS or Frm PC to any CDMA network plz email me at spatilinfotech@gmail.com thanx a lot in advance...
dinesh said:
hey, its a great info, been looking for this. thanks
i am from greece so i use greek speedtests such as www.speedtest.gr and speedtest.forthnet.gr i reccommend you to use speedtest which is located in your own country. otherwise there will be a loss
indianYogi said:
[Tested]
www.160by2.com
catch : u can only send 5 sms to one mob. num in one day
www.way2sms.com
worked pretty fine at first , later the lag time was huge . still give it a try.
kunal said:
i couldn't track the origin of the number 9859106535 . perhaps coai is not updated .
any help???
Shobhit said:
Thanks a ton, if you get the latest one, please let me know.
the courier services of blazeflash couriers is very poor my friend posted me some inportant documents through blaze flash couriers from sirsa to panchkula it is over than 5 days there is no courier
i talked 2 all their executives their responce is very dull they dont even answering in the right way very poor services
i suggest never post anything frm blazeflash couriers
vikky said:
can any bdy tell me how to made free sms to bsnl prepaid mobile phone using my internet
Shubhada said:
Hi Amir,
I am Shubhada, today only i came to know about this blog. And the next moment sending you this message.
I like the way you are. Ur sense of humour, ur talent, ur devotion and totally dedication for ur work.
I want ur 1 snap or video clip, can u send me tht on my mail id? plz.......
Also another way to change the desktop icon size in Vista is to place the mouse pointer over a icon, hold down the Ctrl key and use the mouse scroll wheel to make them bigger or smaller. This will produce smaller changes (bigger/smaller) with each click of the scroll wheel.
stop copying aamir,stop remakes
dont make bollywood a copywood!!
Parikshit said:
Professional Couriers - I dont think anyone can beat them when it comes to third rated service. They are atrocious. I regularly get parcels from Mumbai to my Gurgaon ofice annd the experince has been terrible. Packets have been lost, misplaced, wrongly delivered and delayed but NO one cares or even listens at their Gurgaon office.
Infact you will be lucky if they pick up your phone. Imagine Mumbai-Gurgaon in 7+ days in this age.
PLEASE AVOID PROFESSIONAL COURIER.
Anuj said:
awesome bobs !! Congrats buddy..u deserve it..hope u r having fun..
First flight is one of the worst i have ever seen in my life, 100's of banks and consignment hit my door everyday, but to my surprise three time they couldn't find my address, on third time i sent email, left the phone msg to there staff of my contact number, still they resend the package to origin, they just making gimming to make money. check the link for proof. http://www.firstflight.net/n_zcontrac_new4.asp?tracking1=ZC6693582
please please avoide this courier if you really care your consigment and goods.
Jenny said:
Congrats on the new car! :) It looks nice.
Manoj said:
My frind sent a courier thru first flight. Distance between her office an mne is 12kms and its 3 days now and I am still waiting for the courier.. Hopeless service.. Just cant rely on such people while sendn important documents
tekacica said:
Hi! I'm searching for any Clayderman's notes for very long time, but I haven't found anything. Does any one here have his notes for piano?
Devender Kumar said:
It is very sad about First Flight services. My Pan card is despatched 31th Jul 2007, but today date is 10th Aug 2007, still i not get my Pan card and not even a call also.
So plz kindly do the needful.
Please give contact no./ office no who distribute courier at gurgaon,Haryana
Hai,we need 2007 updates of the same information regards mobile number series of different cellular number series in India.As of now Airtel has released 99526/7 series. and 99430 series.Update soon for new series.
i have visited ur blog and it's very nice and such useful information get for Bollywood
i think u r first blogger in Bollywood
Thanks
Anita said:
I tried contacting the J.B.Nagar office for pickup for three hours but no answer. the secretary at the corporate office gave me another number only to be told that they did not want to do business with me. I called the corporate office again, the assistant refused to listen to my complaints and said that I should keep on trying and hung up on me! WHAT GREAT CUSTOMER SERVCE. keep it up man!
mkdir target_dir
cd source_dir
cp -ap . /path/to/target_dir
mkdir : makes directory
cd : goes to a directory
cp : command for copy
-ap : cp options for copying files/folders with the same attributes/permissions...
. : stands for all files/folders
dude said:
Dude, i needed this feature also, cause my boss does not know how to read. Life sucks and I wished I was dead. But hey anyway thanks.
Looking for my document for the last two days but the Ghaziabad Branch office is not picking up the phone. I have made more than 100 call on 0120-2854469/18 and 9312093986 but the response is zero. I can tell the worst service i found in my life so far in courier service. Plz improve urself and let me know the status of my document ASAP>
elena said:
many thanks for this. has been trying literally for years to figure how to do that :)
yeah i am lookin for that sheet too... BUT I JUST CANT FIND IT! please help me :) that version of mariage d'amour is sooooo beautiful. i've tryed to play it by ear, but i want to check if im right...
First Flight is really pathetic. It cannot deliver goods even to the nearest of places on time and even just to make things delivered they put some imaginary names.Govt should stop them from doing business.My shipment from Allahabad to Bhubaneswar, which they claimed to be delivered in 2 days.And now after a week they have updated their website and made it delivered to some imaginaery people only to make life miserable for Customers.If there is Customer Rights Protection forum that can lead our cause to stop FirstFlight from doing business, please tell.
Gune said:
I visted the country sometime in 2004 and it was an experience I will never forget. Mother Teresa was born in this country.
I have to admit, it is not a very safe place for tourists.
test comment. checking if the comment feature works on the new install.
John said:
I know alot about excel, but didn't know that one! Thanks for the tip!
sam said:
Two tumbs up!
shaunak said:
guys. any cdma network mobile overseas can send messages to reliance cdma mobiles. i realised this when i choose '3' mobiles in australia. no other network in australia can send messages - vodafone, telstra or optus. only 3 can (www.three.com.au) cause it is on CDMA network as well. i am sure all CDMA networks abroad can send CDMA-CDMA messages.
i am justin thomas working in SRL RANBAXY (kottayam)we are getting very bad service in kottaym,several times i have informed abt this to their,manager(kottayam_),ernakulam office,head office mumbai,but no use,we are planning to change the service,this we are not expecting from firstflight(check.h24366034,h243660320
Anil said:
Worst Man... Really Worst.First Flight is really worst ever service U can have. My parents sent a parcel to my home address at chennai. Its almost 6 days and I have not received it. I learned that the parcel has come to my town, Perungudi, in chennai, and the man(First Flight delivery man) was unavailable from the next day. His cell number gives either no response or switched off. He also puts it off when the call is through.(Prakash: number:09962001236). I contacted the Perungudi Office. They saiid, the parcel came there, and left as they didnt find the addressee. The parcel was there only for 2 hours, and left to Guindy(Very Strange). The next day(5th day), I called the perungudi Manager again. He told me he will deliver it to me at my office address instead of home address. I waited at office till 4:00 PM but nothing came. Called the manager again. He says. Sorry, I cannot change the Address without authorisation. You can call the delivery person.(9841978523). Called 5 times to this number. Mobile is switched off.
Waited for 1 hour and tried. An Old Lady picked up. She told \"Phone was left at Home\"(Very Good Deliver Man!!! -Keep it Up!!!).
Called the Customer service cell.(044 42027788). It started with a Voice response System, and then there was silence for 3 minutes. Like making a fool of the customer..
Waiting for my Parcel. since then... with Prayers.
Jitendra said:
what should i do if some one making blank call on my mobile. kindly guide
Bhat said:
Watched the interview on youtube. I was embarrassed for Aishwarya. She was laughing when Dave was not even joking. I think Dave felt a little uncomfortable too. Clear cultural gap here. She should have consulted with Indian Americans and prepared for the interview better.
Bhavana said:
I am a regular user of post paid cards thru Reliance. The quality of the call is good thats why I prefer using it.
But from last couple of days, I am not able to open their website - www.relianceindiacall.com
I have contacted my ISP and they informed that Reliance people need to update their website so that they should allow the new IP address...Can any one guide me what else I can do....
Jay said:
how do i delete the drop down list in the \'search\' program.? PLEASE QUICK
Mrs. Jaya Ghosh said:
Well well, today October 7,2007...... no replies nor does the online tracking show anything!!!! If this is the kind of service received / rendered how on earth can we face the world? Our leaders say \\\" Mera Bharat Mahan\\\" and here we provide this kind of service..... disgusting is the word.
Sir / Madam,
Today is October 3rd, 2007 and I am yet to get status reply to this mail!!! Lets see after how many days I get a reply, let alone the delivery of the document / consignment.
Orijeet Ghosh
P.S. I was not given any discounts nor the rates lowered for me. In fact I paid Rs. 1,035/- and this is the kind of service I get in return for paying the full amount.
> From: jnjghosh@hotmail.com
> To: caacsd@firstflight.net
> CC: ffcl@firstflight.net
> Subject: FW: First Flight Courier Status
> Date: Sun, 30 Sep 2007 09:08:34 +0530
>
>
> Sir / Madam,
>
> I would be highly oblidged if you could kindly give me an update / status of
> the consignment -
>
> tracking no:FE0013840
>
> dated 18-Sep-2007
>
> sent from kolkatta
>
> for Oman
John said:
Thats great!
BuckofromBruthen said:
Hi Bobby,
Looks like you have been imortalised. I think you will get hits on this blog for the rest of the century. Thanks heaps
nice blog.
i thing all ur monthly archives point to ur homepage.
Ray said:
Hi,
I came across your blog which I thought was cool.
I\'ve just opened my own blog (totally new to the blog scene)
I was wondering if you could give me a few pointers or cool plugins you recommend and also how to do the plugins :)
Also here\'s a question - how do you make your blog searchable via google?
Thanks
Ray
Smita said:
Thnx a ton for the very helpful info.. May God bless You.
I found the origin of one number I ws searching for. 9835636326
Couldnt get the co-ordinates of the other number: 9905375396
calls from these two numbers have been incessantly disturbing me since past 3 months. can anyone help me on this front. I will be eternally grateful.
Seems this is the new series released not yet updated in this list.
Shameera said:
Very bad service Professional courier has..Mostly in parcel along with address phone number they write .In my case i gave both land line and mobile number but with out calling they return parcel back. They wont return money also..
gksreddy said:
halo sir,
i am frm hyderabad.i am a big fan of u.i like u r movies as well as ur selection of movies.i suggest u ...give more preference to ur family...d\'t change life partner regularly...ofcourse its ur life...but u r celebrity...people r taking u as model...
Syed Athiya Sulthana said:
Hi
i like he way u are and a very big fan of yours
mail me plz
Athiya
h r u....
dont wary...everything wil b f9..may god b ever with U..
sfa said:
thanks a lot.. looking for long for this..
y dont u start a technical problem solving website?
it could expose my secrets but now i removed them.. thanks...
aish ko meri taraf se janmdin ki bahut-bahut badhai. Happy Birthday aish
karuna said:
it is a rediculous courier services as it writes and delivers at wrong place into the wrong hands.First flight is one of the worst i have ever seen in my life, 100\'s of banks and consignment hit my door everyday, but to my surprise three time they couldn\'t find my address, on third time i sent email, left the phone msg to there staff of my contact number, still they resend the package to origin, they just making gimming to make money.
Rathish said:
I too had the same problem with space for host. There is nothing such as uptime guarantee or customer support for these guys (not these just one guy is behind this). He never takes his phone or replies to email when server goes down.
One time he even deleted all my websites overnight saying that I haven’t made the payment. I submitted all the proof including bank statement to prove it, but for nothing. I lost all my data at their server. 10 sites .... you cant imagine how harsh he was at that time. All my hosted data, my Database files .. all
They have given office address in banglore and other parts. And one day after days of down time I called the so called banglore office and found that it’s another webmaster whose website was hosted for free at spaceforhost.
Even if you have domains registered with spaceforhost, don’t worry you can move to any other host like squarebothers.com. Just get registered with them and from their control panel you can move the site to their control. Of course you will loose the hosting space. Guys at squarebothers.com where really helpful in moving all my sites to their domain.
With about 10 years of hosting experience, I would say space for host is the worst guys I have ever worked with. To all of you guys trust me never register with them.
Recently discovered that they resells UTI banks payment gateway too.
If you want to register a domain register with trust worthy sources like Yahoo or Google. It will cost you 10$, but peace of mind. Then decide the host. I would say go for godaddy.com. They got some excellent offers. If you are ready to pay 6$ a month you can have unlimited sites hosted under them. But have a check on the supported functions and all before hosting. Like they care security a lot and has disabled some php functions, same for mysql.
So domain name go with Yahoo
Hosting go with GoDaddy
Emails go with Google Apps
Payment Gateway Paypal or at the worst case CCAvenue
But never ever SpaceForHost
Rathish
Sid said:
Aamir bhai, aadaab.... when are you getting married next?
I have an idea for reliance & I think this is good business idea.I want to share my idea with reliance. plz contract with me at rohan_sam4u@yahoo.co.in
Rohan Samanta.
Niroj said:
Nothing short of Awful service. Even Awful would be a compliment for First Flight by their response standards.
Biggest Plus Point - The web site does not have a Customer Contact No.. Great thoughts put into Web site architecture. or Perhaps a thoughtful one i.e Going by the standard of service, its good that they have not provided any contact details on the website.
Spoke to this girl Pooja at the Saki Vihar center. She seems to be lost in her own world. Without knowing any details of the person calling, she is first informing that she just now gave all the details to me and then trying to find out who is calling.
Truly there is a need to have a forum to ban such organisations from doing business.
Awful man....
Rathish said:
I had posted here sometime back.. it seems not yet moderated
this is to tell u about another space for host issue
Check it out... My details are also there .... STRANGE GUYS
Rathish
mahesh said:
thank you
wahab said:
lovely job dear its cool
but it should be up dated for 2007 on words
Abinash chandra puhan said:
What a hell service first flight courier is providing to its customers ? My family had sent a parcel on 19th,November from Balasore,Orissa . But I have not received it till now(8pm,27th November). When I contacted the customer care(phone no.-0120-2425383,as I am staying at Noida.) they put me on hold and after 30 minutes they told that they can do nothing for me..Even the customer care executive used slangs to me. I have decided that I will never go to this First flight.
Abinash chandra puhan said:
What a hell service first flight courier is providing to its customers ? My family had sent a parcel on 19th,November from Balasore,Orissa . But I have not received it till now(8pm,27th November). When I contacted the customer care(phone no.-0120-2425383,as I am staying at Noida.) they put me on hold and after 30 minutes they told that they can do nothing for me..Even the customer care executive used slangs to me. I have decided that I will never go to this First flight.
Stephan said:
Thank you,
This issue has been bugging me for some time now.
Tony said:
CTRL+ALT+ENTER may also be required (instead) in some versions of OSX and Excel in order to enter lines within cells.
Ravichandran said:
Hi All,
I am Ravichandran.M. Actually my parents was sent the phone in the parcel through Professional Courier from Karur to Bangalore on 03/Dec/2007. Actually here Yeswanthpur branch those people doesn\'t deliver so I called up them and ask the parcel they said that come and collect like this I collect it and open that in that place, but there is nothing inside, immediately I ask them they said that we don\'t know like this, what I can do for this please help me for this if any one have the power to fight with professional courier.
The worst courier service ever I seen is Professional Courier. So please don\'t use this kind of Professional(thief) couriers any time.
AR was not herself as in interviews in abroad lately. First on cannes, wher she ws ther as a jury membera aftr \"devdas\" was ther. In her interview, she laughs and does not explain a thing about hindi cinema rather she is just ther to expose her beauty and many of the sponsors of cannes are more interested in her beauty and popularity rather than her work in hindi cinema. Her interview on 60 minutes ws the best out of all the interviews she gave including american today, oprah, and letterman, and some interviews she gave in cannes. In 60 minutes, it ws in bombay and she handled her questions very well but was confused on why did she take the interviewer to her fav. store and asked him for his opinions on how she looks on the clothes. In her other interviews, she doesn\'t seem as an actress rather just as a celeb. from bollywood which is popular from hollywood. But the best questions came from oprah which are very simple, but cladding oprah w/ the sari seemed out of place, and yet we all got the same miss.world answers from her in all her interviews. Come on, in 60 minutes, the reason she went ther for india in miss world is show tht india can speak english?
g. krishnan said:
First Flight sucks! On two occasions Standard Chartered Bank sent me a credit card and the courier would not deliver it to my house in Palghat, Kerala, saying it is not in their delivery area -- and I live six kilometers from their office. Their excuse: it costs 20 rupees by autorickshaw to come to my house and so they will not deliver. The first time, a First Flight delivery man came when I was out of town and instead of leaving a note orally told my neighbour that he was from a courier and had a credit card to deliver. No note, no name, no contact information. Nothing. I tracked them down through the bank and the courier said it had sent back the letter. When it was sent out again, they said they would deliver and made me wait at home all afternoon. The next day they called to say that I should come over to their office. The caller said he had not called the previous day and so he was not responsible for the inconvenience. He said he would send back the letter if I did not show up and that he would not deliver. Given that all sorts of courierwallas show up at my door, why should First Flight -- which charges an arm and a leg -- refuse to deliver at my place?
florence said:
hi nice to see ur website.
ioannis said:
wow
kapil said:
This is the most horrible kind of service i have ever come across.
sheetal said:
Hello Sir
THIS IS SHEETAL AN FROM BANGALORE. I WOULD LIKE TO CONGRATULATE YOU ON BEING THE MAKER OF A MOVIE LIKE TARE ZAMEEN PAR! IT IS A POWERFUL MOVIE AND I WILL BE ONE OF THE FINEST MOVIES EVER MADE.
I am an artist running a design studio with my team in Bangalore and i wish/pray that i get a chance to work with a person like you.
GOD BLESS U
Sheetal
Sheetal
dinakkar said:
hi bobby.. i found sme of ur blogs useful.. i have a doubt.. thought u may clarify.. i recently downloaded a movie file frm internet which has extn .wmv
i have a dvd player that can play files from flash drives. so i copied da dwnlded file into the flash drive and tried playing it in the dvd player. but it dint wrk. later i found that the player doesn\'t play files with extention .wmv but it can play files with extn .avi
can u tell mw hw to convert a .wmv file to a .avi file
i dowloaded a coverter but its a demo and converts only the first 90 secs. for more it is asking me to buy...
can u help dude?
saikat said:
hi amir,
i have some good stories for u.
its my only passion.i am a thinker.and make stories
if u r interested den i can send u my story.
A B said:
is it possible to send sms in Kannada(one of the indian languages)to canada from uk.
I think it might bea problem \'coz you\'re using lowercase for all characters or prolly it\'s just a bug in a few gmail addresses. I have been using the label \"Important\" for over a year now. For more proof, here\'s a sreenshot at http://shayon.pal.googlepages.com/untitled.JPG
By the way, just happened to stumble onto your blog. Looks pretty classy. Even I happen to maintain a blog at Shayon\'s Labyrinth. I have been searching for a graphic designer who could help me in designing a better layout for my blog. I was hoping if you could lend me a helping hand.
noor jiwani said:
I read all the comments above and I agree most of them like reliance
has good quality,good connection and best price.
but if you can\'t open their website. all these qualities are in vain
Neelima verma said:
What a hell service DTDC courier provides.I sent a shirt to my frnd but he dinn\'t get.and they dont have any reaction.and thay r not doing anything.There a claim option but that is also a way to make fool.
Kirit said:
Just great...I previously used spacebar key to go to the new line and it was very frustrating...Thank you very much!
AAKi said:
thanx dear for such an info really needed it i rreally don knw hw to thank u
:)
Jyotirindra Ghosh said:
Hi Mr. Aamir Khan I\'ve seen your great creation \"Taare Zameen Par\". I can\'t believe that this type of movie is created in Indian Film Industry(Hate to say Bollywood) if I donot see this movie. Really core of my heart this movie is a milestone of the industry and I want you will make this type of great creation and make Indian movie more prosperous. I hope you can fulfill our desire.
thank you Aamir. take care.
RITESH said:
actually i want to know how can isend free sms to reliance user except by email
bobby said:
hi aamir.........this is bobby from bangalore.. am a die hard fan of you...i have watched all your movies till date....
recent one was taare zameen par.. its an fantabulous directorial debut for you...i heartly congratulate for the movie,your success, the way you have brought the concept of dyslexia..
there\'s no doubt in saying that TZP is the movie of 2007..
good job aamir...i wish you continue making such wonderful films and am looking forward for your ghajini...
bobby said:
hi aamir.........this is bobby from bangalore.. am a die hard fan of you...i have watched all your movies till date....
recent one was taare zameen par.. its an fantabulous directorial debut for you...i heartly congratulate for the movie,your success, the way you have brought the concept of dyslexia..
there\'s no doubt in saying that TZP is the movie of 2007..
good job aamir...i wish you continue making such wonderful films and am looking forward for your ghajini...
deeepika said:
search 9250729721
ankush jain said:
Hi,Aamir.Thanks for making taaren zameen par. It was such a wonderful film that after watching it iam not in state in conrolling my emotions.I hope Gajni will also proved to be a nice movie
Slevin said:
FF Sucks big time. I am awaiting a delivery, the dispatcher has sent me the consignment number but FF says they have not yet received any such package!!! PHEW! And further say that the dispatcher might have updated before the actual dispatch! How did he get a consignment number then?
What also amazed me is that their site only list contact details of a few cities, not all!
I guess since FF is the official courier for IncomeTax Dept., various banks, it really does not worry about other consignments!
Best in my view is IndiaPost Speed Post.
pooja said:
hiiiiiiiii.......Aamir sir how r u?.....i like ur face bcoz it looks like chocolate...and i like chocolate.very much........my fav movie is taare zameen par.......in its own sense......bcoz i like kids.....they god\'s pure gift 2 us.......plz reply me......did u like my comments.....plz sir.
Saurabh Parmar said:
Hi Aamir
I am a very very ARDENT fan of your\'s (like millions of other).I think this bolg has given me the great opportunity to tell you what my heart is feeling for you since i\'ve watched QSQT.i always like your work & almost all your movies are my favourites.But Special Thanks for giving us Taare Zammen Par. The movie was like a beautifull image of childhood drawn on the canwas of silver screen. The character\'s you portray in your movies are very skillfully crafted may it be bhuvan, aakash, raj, sanju, ram nikhumb, sidharth marathe, munna, raja, amar .... I hope we\'ll see many more such characters in future. Good Luck.i\'ll be in the touch with you.
Your\'s Saurabh
vishal singh said:
hi. MR. A.K SINCE QSQ TO TZP UR WORK HAS REALLY PLEASED US . KEEP IT UP. HOPE TO RECIEVE WONDERFUL WORK FROM U IN NEAR FUTURE...
Ruth said:
I am so glad I ran across this solution. It has been driving me crazy. Now if you could tell me how to solve another problem, I would be most grateful.
On yahoo games using Vista, the text is so small. I changed resoultion and made it better but that messes up the other pages. Is there a way to change the text to larger. I have ran into lots who have this problem. Thank you so much for your help.
huma said:
hi amir
thank you so much for giving such a nice movie.it is surely the movie of the year.i am a doting mother,i think from this you can guess my state of emotions while watching the movie.
i guess a person of hard nut shell would\'nt have controlled himself?herself. it was very moving.
yah i cried a lot.
luvit said:
it was so helpful
Anoop Aravind said:
thnk u very much for the instant help that this infrm bcame for me, a very gud job that u did by posting the link here, like many i too didn\'t know that every operators codes state wise could b found at one place.....thnk u again
Suyaraj said:
use smsintegra.com to send SMS to RIM/Tata indicom and any GSM mobiles. it\'s very easy and very fast. you can easily set your senderid also.
Suyaraj M
satya said:
Thanx buddy
I finally got it which I was looking for
satya said:
Thanx buddy
I finally got it which I was looking for
Surya said:
Thanks! just what I was looking for!
daksh said:
hi aamir....u rock
ASMA said:
HI AMIR, I JUST WANT TO SAY YOU ONE THINK THAT MOVIE IS BEST BUT YOU MUST BE SURE WITH YOUR FAMILY FIRST WHAT ARE YOU GOING TO DO WITH YOUR KIDS? IS IT OK THAT YOU LEAVE THEM FOR A WOMAN ONLY ? YES I AM ALSO A RESERVED PERSON LIKE YOU DONT LIKE TO SHARE MY LIFE WITH ANYONE BUT A PERSON WHOM YOU GET MARRY AFTER A LONG PERIOD OF LOVE AND YOU HAVE LEFT HER?AND WHAT ABOUT YOUR KIDS ? DONT THEY DESERVE YOUR CARE FOR THE LIFE? I AM NOT HAPPY WITH YOU AMIR. BEFORE YOU SAY ANTYTHING YOU MUST DO IT IN YOUR LIFE FIRST .
can u make a film, on him who trie\\\'s his entire life to become a film director, and eventually he fails to fulfill his dream , and he don\\\'t know exactly what are the properties should he have to become a film director, in that dream he may miss his family, friends, and all those who loves him,
tell the crazy people what exactly going on the sets, and not to spoil there lifes.........
hi sir
i am nurat a die hard fan of you. i saw your latest movie taare jamin par. i really like it. congrulate for your the succes of your movie.
buy
papia ahmed said:
aamir,
how did u do such creation?yes i m talking about taare zamin par?i dont have words to praise....still i m sending this.hope u will understand .and i will be waiting for another creation like this...
uffffffffffff,its hell with FFL courier.The day before i went to this salt lake city based FFL n as it was mt very first courier to abroad i asked f all inside n outside good n packin all good n all.The person who was in a counter said all good,showed him package n asked whats the amount.He told me the amount but i wasn\'t caryin that much so asked him f i can make it latter,he said do it tomorow btwn 10 to 11,then it will be better for u.I asked him 2 take it now but he didn\'t,then i said to him dhl askin double then what u askin,are u shure u sayin the right amount,he said yep,i was shoked with the diff.i was happy atleast some one understan the need(as in other what u sendin is leser amount then the courier charges they ask for).So today again i went in the mornin at 10.30 as per his sayin,n BOOM,the man sittin their said the amount atleast 1000 rs. more then what the earlier man said,i was aghast by the difference,now even after takin whole of my purse i was again short of cash,back to square one,came back without giving and waited for my husband to come and give me cash,he came and took amount from him,then rush back,got the previous day man in counter,told him u said this much so bought this much now the man who was here previously said atleast mlore then 1000 rs difference,he said done the mistake,i agreed humanly error can be done,asked him first to make a roughly figure,he told me,i was ready to pay,he send me to 3rd floor to ask for some dec.aration form,then the otjher man said not 3rd,u r in a wrong department,woowww,tjen was send again to 2nd floor,their a security guard tellin me u have to write in a paper,your whole biodata,n content in paper this parcel holds,ohk,then said not here,u go down again back to the man in counter and he will tell u,what the hell,ohk,then went down back to the counter,fine,now BOOM,he says they didn\'t told u lets go upstair,wooowwww man,i had enough,said what u all think of me,some marchin parade woman,
came out,no more of FFL eva u nless n u ntil its life n death situation,even sayin u i will prefer death then goin back to FFL
Anoop said:
Realy great info....Thanks much
Is it possible to find out the contact details of the number
saroj dahal from nepal said:
waiting 4 reply
Aliya said:
Salaam mr.Aamir khan,
I am Aliya from Karachi.One of your most ardent and faithful fan.you are the most talented actors in the history and this new movie Taare zameen par is the most amazing movie.I have seen it so far for only 9 times and each times the emotions are the same intense and powerful and each time i cry.i dont have words to praise you ,your movies and TZP.i have never sent any mail to any celebrity nor i ever had the inclination but you are an exception.i never admired any one more than you.my wish for you is to get an oscar one day and that day will come soon....Since QSQT you have been my most favourite star and you will always be . waiting desperately waiting for Ghajini....
take care.
Samrat said:
Hiiiiii, Aamir
I am a great admirer of your work.Aamir ,pls tell something about your upcoming Movie \'Gazni\".Onemore thing that what is your stand regarding not attending award ceremony held in India.
uma said:
I agree with all of you.I am in london and i sent a courier to chennai which supposed to deliver in 3 days time but wasn\'t...when we enquired with tracking ID they told that the courier have no Recipient name on it and that is the reason they didnt deliver....What an irresponsible answer!!!!!.....Does anyone accept a courier with out Recipient Address on it........I have the receipt with recipient address which is given by first flight london office and that is my proof that i sent the courier with recipient address on it....what a rediculous service..very much frustrating.....i advice everyone, please be careful in sending the items through the irresponsible and cheater courier like this.....it is worth to go to consumer court on First Flight couriers.....i will support also.
NEVER EVER USE FIRST FLIGHT COURIER IN FUTURE AS THEY ARE CHEATING AND FOOLING THE PEOPLE!!!
Uma
abhishek said:
hi! amir ur TZP is just amazing i\'ve watched it 10 times & planning to watch it some more times
BENAZIR said:
hi dearset aamir.
i m big fan of urs frm behrain
i really loved ur first directorial film TZP. i was before great fan of urs acting,now i m also big fan of urs as a director.
i know this is not enough t say about ur self,but i dont hav words to say anything to u.pleeeeeeeeeez keep going on and giv us the great great creations of urs.
i m despretly waiting ur an other project called GAJINI.
tc,love u alot
I was looking around for the solo piano version of \"L for Love\" for a while and you brought it to me! As a matter of fact, I love Clayderman\'s songs, but I don\'t know why he mixes trifling sound of non-Piano instruments with the great sound of Piano ;)
Riya said:
\"TARE ZAMEEN PAR\" Outstading, Excellent, Brilliant etc.
Bollywood has very good actors like Om Puri, Aamir Khan,Paresh Rawal, Anil Kapoor etc. But who is making good use of their talent? These people can rock the world, but indian directors don\'t use their mind and has been failed to give them work equal to their levels. Aamir, I am glad to watch your movie Tare Zameen Par. You have done very good job as a director/actor and I am hoping that your upcoming movies will also be outstanding because that makes you Aamir.
Wish you best of luck.
Regards,
Riya
Sachin said:
Exxxxxxxcellent
manoj said:
it is not possible to signup on aamir\'s blog. can help? the following message comes:
Parse error in query select count(id) from aamir_user_info where lower(login_id)=lower(\'MANOJ\')
Connection is
thanks
lene said:
AMIR FIRSTLY many happy returns of the day,but i wud like add that by u claming u r no.1,is pure foolisness,coz srk has made a place for himself in the industry n that\'s not change,people will always luv n adore him,n he will always be no.1 n that\'s not going.He rules bollywood n he always will.U can\'t take that away from him!
kalyan verma said:
Hi Aamir,
WISH YOU A VERY HAPPY BIRTHDAY
Yours
(One AMONG URS countless fans)
kalyan
Pizzazz said:
Oh my god, I thought her eyes were real!!! She fooled us big time. Why doesn’t she just admit it like shilpa when there are hard core evidences of her alterations floating about the net? Check out this old photo from back in the day… HER EYES ARE BROWN!!!!! NOT BLUE/GREY.LOL.
If she can do her eyes which is what most will not mess around with as it is vital to anyone’s career, god knows what else she has done! She is also done that skin ligtening shit as she is well dark here!
hi dude know what your camry sucks....sucks a big time...dude pimp your camry....its a good car....i wish i could have it but....any way man put some kick ass spolires on it...fire postures of the sides....scissor doors....kick ass rims....n lower it...hope u take my advise
Deb said:
Great info. But still couldn\'t fing origination code of 94337 in the list? Any ideas? Wonder how often this list is updated. Thanks again.
Chris said:
That is hilarious! I have not seen any of their pranks before.
mahesh said:
hi amir i am calling u amir because u very close to my heart & i am an mechanical enggineer and i always have a dream to meet u and i know i will meet u
anjjali said:
hi sir i cannot recive mms in on my mobile please tell me how to cheak it
Jamuna said:
Come on ! Can Americans speak English? Ash spoke better English that most North Americans. She is not raunchy like ther Hollywood actresses. As far as \"accent\" is concerned, we ALL have one, you morons! She has a standard accent - a polished and refined one. You N. Americans keep stressing the \"R\" all the time and mispronounce basic words like \"often\", \"leisure\" and \"kilometer\". Would you make the same remark about Mr. Swartzneger\'s accent? What about Selma Hayak\'s? What about your own? Sorry, you guys aren\'t beautiful as Ms. Rai.
Bobby said:
@Brajeshwar: Thanks for the note about the MD5. I generate my MD5 in Linux using the \"htpasswd\" command. But for someone who needs .htaccess but does not have shell access (example: FTP access only), the MD5 version of the password is definitely required. Thanks for the tip!
Bobby said:
@Chris: Yeah, their pranks are nice :)
Excel Novice said:
Thanks Bobby - you're my Excel hero!
Anna Mehrabyan said:
Hi everyone...I,ve been looking for the notes of MAriage d\'Amour for a long time but I can\'t find it ...Can anyone help me...
HI Aamir I am your fan and I want to know will you work with Salman Bhai?????????????
Deep
Ziaur said:
Amir bhai assalamalaikum...amir bhai i am not saying that i am huge fan of u....mai sirf apki shaksiyat aur apki qaabliyat ka dewana hu..TZP proved ur varsetile genius..sach me u have given new hieghts of indian cinema....bhai i belong to a small town of u.p....i want to become a part of ur film production...plz giv me a little chance..i wont let u down.waise ap mitti ko b chu de to sona ban jaye.....amir bhai i\'l wait ur respons..ALLAH HAFIZ
Bharat Raj Dhakal said:
Sir namaste.I am from Nepal. I am planning to a thesis research of M.A. English from Tribhuvan University on your Film Taare Jamin Par.I liked this movie very much because it touched my sentiment.I assimilate myself with this movie.I am going to apply Literary Trauma Theory on this movie.I hope You will help me.I am seeking positive responses from you.
Riya said:
Lena that only tells you are SRK fan nothing else hahahhah
Sachin Sharma said:
Thanks a lot for this. Saved a lot of time for me :)
jitu said:
Dear Amit
here a Joke for you
Before the marriage:
He: Yes. At last. It was so hard to wait.
She: Do you want me to leave?
He: NO! Don\'t even think about it.
She: Do you love me?
He: Of course!
She: Have you ever cheated on me?
He: NO! Why you even asking?
She: Will you kiss me?
He: Yes!
She: Will you hit me?
He: No way! I\'m not such kind of person!
She: Can I trust you?
Now after the marriage you can read it from bottom
isn\'t it nice??
Vishal
Shivani said:
Hey Aamir..
This is Shivani...Like many others i am big fan of you..I like you for your acting skills . May i know what else you like to do in your free time.
hellow amir khan jee aapki films dekhi sari ki sari ok lagi . hal hi me aai film tare jamin pr children ki problem dislexia pr based thi . really it was a very good film , very good imotion film. really great and also great lagan, sarfros, isqu, mela,hm hain rahi pyar k, mangal pande, andaj apnaa apnaa ,earth 1947, rangila, gulm, vikas saini shree ram nagar makrana rajasthan
Just enter the first four digit of the ten digit mobile and get the operator and state details.
Enjoy.
akbar hussain said:
asslamualikum aamir khan saab.how r u hope u r doing well ,im a dieng fan of u i like ur acting and ur latest movie tzp is brilliant i dont know how many times i cried on watching tzp well done sir thanx for tzp keep it up
ALLAH HAFIZ
tutun said:
hai amir kaku tomake dekte eche kore..ki kori balo to?
wow, that was great post.. thanx for sharing the same...
Mobile Social networking
rahul rajagopal said:
hai aamir,
i am a big fan of urs from kerala.the movie which made me a diehard fan of urs was fanaa.exceptional performance.i am eagerly waiting for ur upcoming gajini.hoping that it be a block buster.
all the best.
tania said:
hey aamir , i always gave u credit for th movies u hav worked in and i thought of u as a matured sensible guy ... but this silly blog statin bout a dog named sharukh is degradin ... i mean wat is it wit u celebreties .. how lame n silly can u guys get ... havin these silly 6 yr old fights namin dogs named after each other ... grow up hunnie ... get real ... there r better places n better ways u can spend ur time ...
imran haque said:
hi this is imran and am a big fan of urs
and i wanna tALK 2 U
PLZ CONTACT ME AT funky_imran_haque@yahoo.com
Hi dear friend
i want to buy one of the Richard Clayderman`s albums.. what`s ur idea for it?
i want to help me in this case in the order that i fly between songs of this artist.
My email address is: r_sakhaei@yahoo.com
THANKS
aishwarya rai is a fake WHO has done plastic surgery on her fACE think guys she also has layers and layes of makeup on i mean im a girl aswell and younger then the beauty queen lolz!!! so if i had or you had that much makeup lightening camera tricks contact lenses ect on wouldnt we look as beautiful????
isha said:
hi amis m a gr8 gr8 fan of ursssssssss
love watching ur films
my all time favourite is quamat se quamat takkkkkkk
u loooked so cute in that
i wish u all tha very best
an wish all ur forthcumin films do well as a director as well as an actor
kp smilinggggggg alwayssssssssss
lalit said:
hi amir , ur my favourite actor . i don\'t see movies because today the movie masala lacks the basic thing i.e the story . i want full paisa wasool if i go to hall , but what usually we get a bunch of songs with avg. or below avg. lyrics etc. i see ur films because i belive that ur movie will give a story to understand and enjoy .ofcourse A.R.Rehman provides the wonderful melody to the film.
bill said:
i have amac and dont have all the stuff they tell me to use,i want to clear google search menue drop down ,i go thru fire fox, please respond,as you can tell iam new to this
salam sir
i m ur dieheart fan . today read newspaper and knew that u apologise shah rukh\'s matter which shows that Aamir khan is gentle man.
sir this is my humble request to that when u get my msg plz reply me
Salam
It is real pleasure to me if you read me ! I am a great fan of your and also try to do and think for better for mankind by www.rokto.org
I saw your all movies and respect you as perfectionist. it is tough job you do with your versatility. Salute to you because we all are performer in our own audience but few are successful in true sense. hence I wish you all the best and invite you Bangladesh. If you visit and comments on my philanthropic work www.rokto.org my work will be successful in a way, so I invite you in Bangladesh and if you come here please let me know i would love to share some views of life with you because i know you are a philosopher.
HI AAMIR SIR HOW R U
I LIKE EVERY THIN ABOUT U.
BUT DON\'T LIKE ANY COMMENTS ABOUT SHAHRUKHAN WAY U FIGHT WITH SHAHRUKH U MUSLIM AND HE ALSO MUSLIM SO U WAY U MAKE LIKE THAT\'S NOT GOOD. SO PLZ.
DON\'T SAY NEXT TIME ANY COMENT ABOUT SHAHRUKH OK PLZ ...
DONT MIND.
MEHBOOB
FROM
SAUDI ARABIA
diablomx said:
Lol you saved the day, thanks :) Damn excel.
प्रतिक्षा said:
i just wanna say u \"hello!\"
Saif ali said:
Hi! Mujhe aapki film Taare jameen par bahoot aachi lagi.
U r Really Best actor.I m in 12sci in Dabhoi(Baroda)
Sandeep said:
i want to register my TATA indicom Number of Delhi to my yahoo messnger I am on SMS SERVICE. How to do that as i put my no starting frm 9210****** it sayz it is not correct.plz Suggest meah some measures
Snehashish Ghosh said:
Dear,amir
love and best wishes to .i am a big fan of u. i want to know about your struggule life..How u make over this kind of situation....
with,lots of love & respect.... snehashish
Your blog is amazing, keep it up.
Regards / Kishore Pinto
hari nair said:
I have also enjoyed the miserable service of first flight. The consignment booked for Agra on 29/05/08 from Pondicherry is still onboard their flight. Not even able to trace the packet or have bothered to answer my repeated reminders for the status of parcel. Really these people do not have a sincere team working inside nor have any organisational capacity
vick said:
u r superb bro. if u know about mobile directories plzzzzzzzzz tell me via e-mail
thanks.....
hi aamir i am not ur fan but love ur acting dude u r a real perfactionist!!!!!!!!!!! regards zaara
Manikantan said:
The worst courier company atleast I have come across. The delivery boy in bangalore has forged the signature in the delivery challan and updated the status on their site to as \\\\\\\\\\\\\\\"Delivered\\\\\\\\\\\\\\\". How can one trust this first flight. The company that works without any morale and principle is First Flight. They should exit from this business if they cannot deliver the consignment. I believe the Indian Postal Service is definetly reliable that these guys.
I guess all ICICI* entities use First Flight for delivery of consignments. This should be wake up call to ICICI* and many such companies that use First Flight to re-evaluate First Flight and then decide is it worth to continue their relationship with a company that is so UNRELIABLE!!!!!!!!!!!!!!!
Reena said:
Hi Aamir, you are the best actor in the bollwood cinema. No one can compete with you. I can not wait to see more movies from you. your movies are so touching and i can watch them over and over again and never get bored. you are my favorite actor and God bless you so you can keep making your fans appreciate you more and more with every movie that you do. Also, my mom cant stop watching Taare Zameen Par, she cries every time. Please repond...or even just say Hi, that will make my day.
love you lots, Reena
Reena said:
Hi Aamir, you are the best actor in the bollwood cinema. No one can compete with you. I can not wait to see more movies from you. your movies are so touching and i can watch them over and over again and never get bored. you are my favorite actor and God bless you so you can keep making your fans appreciate you more and more with every movie that you do. Also, my mom cant stop watching Taare Zameen Par, she cries every time. Please repond...or even just say Hi, that will make my day.
love you lots, Reena
Dr.Ajay sharma said:
I am thankful to you. this information very-very important to cyber crime investigation.
Hi I M ANJALI SHARMA.I WANT TO SEND SMS TO DUBAI AT FREE OF COST.NUMBER IS STARTED WITH THAT CODE(OO97150.......)
PLZZZZZZZZZZZZ TELL ME HW CAN I SEND SMS AT FREE OF COST.IF ANY ONE KNOW PLZ TELL ME PLZZZZZZZZZZZZZZZZZ.
BHARAT said:
Very good Information but i want to know the circle or location of the city also if some have any informtion pls let us know
Jason Loader said:
I tried using this shortcut in conjunction with windows XP scheduled tasks using \"wake the computer to perform task\" option but the computer doesn\'t wake!! I tried it again using the power options and the scheduled task does start after waking the computer. I tested this inconsistancy a few times with same results. Strange.
Prasanth said:
\"Excel\"lent Bobby!
iva said:
you guys are all funny. This is basic functionality - look in Excel help, Keyboard shortcuts. Spend 10 min and it\'ll save you a lot more.
rajeev said:
hi amir
my self is rajeev from jodhpur. it was great moment when i saw to great legends of thier field i.e u and sachin during ipl final. amir i m really like 2 thnk u for \'taare zameen par\' movie. but im dissapointed when u wrote in ur blog about sharukh. i only advice u 2keep awy yourself from such issues. ok bye nd take care
Pradeep Jayaraj said:
First Flight is the worst courier service I saw in my life time. I got an important mail to be delivered from Mumbai to Chennai. After keeping the mail for two days they returned it back to the sender. When I checked it online it says address insufficient. If they can\'t find a address in chennai then they are not fit to run a courier service.
When I called to customer care they said my house was locked so they send my shipment back to the sender. My house and my office are located in the same place . They are open 24 hrs. I don\'t in which house they checked. I missed an very important document becoz of First Flight.
Gary said:
Merci! I am dying for it!
faisa said:
Hi Aamir, you are the best actor in the bollwood cinema. No one can compete with you. I can not wait to see more movies byeeeeeeeeeeeeeeeeeeeeeee
Just enter the first four digit of the ten digit mobile and get the operator and state details.
Enjoy.
Mohinder said:
realy it is so good and helpful
kamnan said:
Thanks dude. This is a great help.
faria javed said:
HI AMIR,
U R MY FAV.ACTOR.U R DA BEST ACTOR IN BOLLYWOOD AND BEST DIRECTOR ALSO I WATCHED TAARE ZAMEEN PAR ABOUT 20 TIMES ITS SUPERB MOVIE.YOU R THE ACTOR WHO DO EVERYTHING WITH GREAT DEVOTION YOU WNT EVERY THING PERFECT WHICH WE SEE IN YOUR MOVIES.ALLAH AAP KO DIN RAAT CHOGNI TARAKI DE.PLZ REPLY .TAKE CARE OF YOURS.BYEEEEEEEEEEEE
talib khan said:
hi mr amir
im fan of super khans
u are my fav actorof bollywood. i like ur all movies but tare zameen par and lagaan most popular and super hit movies. all film industry accepted u as best director. but i dont like ur bad for srk. u said him that srk like my dog or srk my pet name. i thik u will have joked but that bad. plz be gud friend for srk like sallu. plz avoid amitabh bachchan bcz he wants success by all khan. but why he want like this. he think that he s big super star than all khan. u better know his all movies doing flop continously but all media are faouring him. media telling amit all movies hit but all movies are flop so avoid amitabh bachchan bcz he want success by you
plzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz avoid amitabh bachchan
syed said:
Dear Mr. Amir
I know what I am going to tell you is 100% true in my point of view, but since I am nobody for you so you will just ignore it, though I am executive NRI but comparing to the person I am talking about I am just an ordinary man.
I noticed for the last few months you give too much importance to great Mr. Amitabh Bachchan?
When you released Tare Zamein par you were dying to show him, who the hell he is when you made a great movie everybody will appreciate and it did appreciated all over the world. Same thing I noticed last week when I was watching AAJ TAK and you were talking to Mr. Bachchan, it was looking like he is the ultimate
I do admit as an actor he is superb, he is a class of his own, but at the same time how can you forget when he ignored all the KHANS to invite on his son\'s wedding, how can he ignore you and Shahrukh even he did not invite Mr. Dilip Kumar, whom he always said he copied. Doesn\'t it shows something why don\'t you people( you Shahrukh Salman Saif) make a group and stand against this kind of communal people. If you can\'t stand against this kind of people at least you can ignore him by not giving importance to him, like what Shahrukh is doing.
Tell me one thing everyone knows you never attend any award function, but still all the award function including Filmfare nominate you and many time you win too, but why IIFA has not nominated your movie Tare Zamein par, do you think it happened without the consent of Brand ambassador Great Mr. Bachchan.
I do not know I may be wrong in your point of view but I noticed many times his attitude has changed after the marriage of his son,
Vinod Kapoor said:
Hai amir its kapoor from land of snow Himachal. boss i m ur small fan plese come to our himchal. We want to see our Hero in Himachal. why u make ur movies in other countries we have most beautifull places in our himachal .plese come to our Himachal. and become himachal\'s brand ambessdor to save its culture. \"WE NEED U AND UR HELP\".
arish said:
hi amir u r very nice bhut sharukh is better then u b.coz he is great human being u r a selfish man learn from sharukh about humanity
Sajjad said:
Great tip, I had been looking for it for so long.
Martin said:
The camry's engine is rubbish. 117kw and 9.9L/100km. Kia-Hyundai have a new 127kw engine, same displacement and does 8.4L/100km on the automatic tranmission.
Amir Dada,
I impressed on ur acting. Ur movies teache more about any subject. \"Kisise payar karna\" ya \"flart karna\", \"Despremi homa\" ya \"Desdrohi hona\". I\'m a student of painting, I got many ideas, many subjects, many images & many more from u. u r like \"godfather\" to me.
I don\'t belive in god but, I belive u . U R MY GOD.
IF U REPLY. I\'LL BE PLEASED. PLEASE DADA.PLEASE.........EEEEE...
miguel andrade said:
hello there, congrats on your new ride. see i have the same ride a toyota camry le, and a week ago i bought a 6 disc changer jbl with bluetooth, and i dont know is it really fit, did you know what i need to install it? thanks
Thanks, I\'m going to sign up for this now. I didn\'t like the monthly subscription on eFax either.
john said:
thanks a lot for the information. if there is a chance to trace the person and the address of a particular mobile number, it is very easy to trace the culprit who sends abusive messages and does unwanted calls. thanks a lot for it
billhates said:
thanks man.. this problem was killing me for long time. Stupid Micrsoft!
ganesh said:
i read you producing film on farmers suicide.being a farmer i can provide various reason for suicide.and solution which may help you to make story plot.
thanks
pooja said:
Hi Aamir,
U r too smart to do movies in bollywood, how is ghajni going, i\'m from TN, our director A R Murugadoss, was a talented one, we know u, wen u selected the movie and d director. Its immense pleasure that our director working with u. Definetly this film will give u lots of craze among girls, u\'ve lots of craze among girls in north, but this film will take u to reach every nook and corner of INDIA. All the best, i wish u the film would be a successful one, and it will be a milestone in u\'r life.
rohit dubey said:
plz show me the city from which the number 9179570075 belongs?
nirmish said:
thank you very much i was looking for this since 4months thaks a lot thank you very much
god bless you
Useful site, but i couldn\'t identify the no series starts with 90427, this no belongs to tamilnadu. plz help me. if anybody could help me, plz mail me to dhaarvi@gmail.com
Karen said:
Hi,
I get a drop down menu in a google search but it is not web sites I have been too or would ever go to. Deleting history does not work. I do regular clean up on my PC. Things such as cleaning the regestry, deleting history, cookies those sorts of things. What else can I do to get rid of this? I have had this annoying problem for two days.
"Reliance" is Indian trade mark only.
Many shops hade phone cards for call. http://www.phonecardsco.com/ also reliance phone cards,but not inian.:)
Shammi said:
realy great help specialy 4 the people who are irritated from wrong calls , and can\'t find the location of the particular number at their own , thanks
ahmed said:
thanks a lot man the link was very helpful. is it some sought of clasified information or what?
I need to integrate the mobile number locator into my website.While searching the database it should not redirect the page.
I need it completely private label on my website.
Can anybody provide me the help
Regards
moneek
Chandru said:
Hi Guys!!
Do we have any website as to search the Mobile or Land Line phone number of an individual by his complete name, with or without his complete address, if so pl. let me know about it on the above mentioned email ID.
regards
Chandru
Mamun said:
Hi......Aamir........I am a big fan of you. I am from Bangladesh. Pls. keep giving ud the film like Dil chahta hai and Tare Zamin Par.
Allah Bless you.
Mamun
Take
chotti said:
hiiiiii aamir.. i m a big fan of u .... ur new hair style is superb..
Ashutosh said:
Can anyone please tell me where does the series 9769 belong to? I got a call from this number but on dialling back it tells that number is not in use.
Nicole said:
I\'ve been using Faxitnice for several months now, and more often than not I have problems. The web interface can be painfully slow, and the Faxtastic application doesn\'t refresh properly (usually I have to close/reopen to get a refresh). I\'ve opened 3 or 4 service tickets and it\'s usually several days before I get a response. There isn\'t enough in the way of documentation, either.
While I have successfully sent faxes, I have yet to successfully receive one (service ticket response was \"this feature works\" with no further explanation).
Hope others have better luck than I have. If you haven\'t already signed up for this service, I\'d advise finding a different one!
NITIN said:
HI AMIR,
I\'M ONE OF THE BIGGEST FAN OF YOURS BUT AM QUITE ZAPPED TO WATCH THE ADVT OF TATA SKY. I THINK NONE OF YOUR TRUE FANS WOULD HAVE LIKED IT B\'COZ OF IT\'S BAD THEME & BAD EVERY THING INCLUDING YOUR PERFORMANCE. I\'VE WATCHED ALMOST ALL OF YOUR MOVIES & EVEN MOVIE LIKE TUM MERE HO. PLS TRY TO AVOID THESE CHEAP ADS FOR MONEY.
Hiii.
Aamir vhai..
Assalamualaikum..
I would like to request you to make more movies bse you are getting late as your age is increasing day by day. you can produce movies in diffrent ages i know with the help of your creativity. but we want to see you as a hero in the film. i dont know wheather you will consider my comment or not but as your fan i have right to commend.
ok take care of urself..
have a long life.
Himanshu said:
The number seems to be originated from Pune or Mumbai.
Hi this is Asma Shaikh.We Routesms Ltd provide bulk sms & sms gateways to our clients who are into Marketing , Advertisting and Event organizing who are looking sms as tool for informing customers about their products, events and social gathering.We provide worlwide bulk sms services at a reasonable price with quality network .
The quickest and most convenient way to get free software with Low prices of BULK SMS.We will also provide a HTTP interface for the end user using which they can use HTTP URL deliver the messages.Please look forward for our coverage map, visit our website http://www.routesms.com.
We provide different Interfaces given below to send these sms with 24X7 Techincal support
1] Desktop Application which you can send sms directly
2] DLL which you can integrate in your software to send sms .
3]HTTP URL Link which can integrate into your website to send sms.
4] SMPP.
Kindly come online on : MSN id: asma.shaikh@routesms.com for further discussions, clarifications and testing of our services.Yahoo id: asma_routesms@yahoo.com, Skype id: asma_routesms.
No setup fees.
No monthly fees.
No license fees.
No maintenance.
No training required.
Only pay per SMS.
If people think it is an advertising message and do not receive such message again, please click Remove My email id from your list
This is dhruv from Florida.With Diwali around the corner back home,i have been busy scouting for bargains on indian calling cards.i found that reliance calling cards are offering the best value for money,since they have slashed their calling rates to as low as 5.9 cents/min and also offering 120 mins free talk time as an addon.Guess mom won\'t complain now that i never have time to talk to her!
rohit tandale said:
amir khan is very good actor..but last 3 years he becomes best... i can say king of king..or \"OSCAR KING\" real start gives to india for bollywood film nomones to oscar we have to give all credit to aamirs .....
\"I M WAITING FOR GhAJINI \"
Hi Amir khan i am very happy to that i have to get chance for post my comments and viewes to u. First i salute u for your work to our nation.I have very inspired from u.
ruth said:
if \"iva\" uses Help so much, I wonder why she/he is reading this.
aman said:
pls tell me how to details a phone outgong & incoming
Shahin said:
Tare Zameen Par was cool, but I don\\\'t know if it was \\\'inspired\\\' by some western movie. I kind of loath that.
I think Amir is an intellectual and quick witted person, but I don\\\'t understand why things have gone so wrong in his family.
Watching TZP I could make out one thing, there was some personal touch to that, remember Amir is a college drop out and his brother is also struggling.
mani said:
she has blue green eyes.not brown eyes.and her english is nice,which most educated indians do have.and indian race has both light skinned and dark skinned people.she is light skinned.if u dont knw much abt india and aishwarya,plz dont comment bad about sumone.
sins come back on you - said in all religions. ACCEPT THE FACT,THAT SHE IS THE MOST BEAUTIFUL LADY EVER
I love you my love more than love too death ... mobile :00965661499354
Jan said:
I am a Chinese, and will go to New Delhi in Feb 2009. Would any friend of yours be kind enough to show me the cost of how to buy a mobile number, and what will be the cost per min calling with mobile from India to china?
Aamir i rally appreciate u for the type of physic u have developed . it has now encouraged me to so that i can be at least be appreciated by others. thanks aamir . u r truly a person of great potential.
Vishal said:
Hiiii..... Amir r u really rockstar i watched ur ghajni flim..
k chopra said:
I got a missed mobile call yesterday from India. Could you advise the best method to trace back the details of the telephone number where the call originated? Call back on my mobile wouldn\'t allow the call to proceed.
Thanks
Regards
Kanwal
akshay jadon said:
Namaste Aamir..........my self akshay stu of class10th..........
........after seen Gajini my aim is to be made a GAJINI part 2....
abha said:
hiiiiiiiiii amir its nice to see ur movie ,u r one of the best actor & my favuorite actor !!!!!!!!
Rajiv said:
Hiiiiiiiiii amir
recently your toal films r superior, ur acting perfaction is so good. i saw gajani wonderfulllllllllllll acting.
Ernest said:
I luv ur 2007 ride,juz wanna know if u can sell me ur 1992 camry by d side.
Akramul Jakir said:
Local Delivery of Abhayapuri (Dist - Bongaigaon, Assam) very good for Flowing couriers - BlueDart, MiniCourier, Flight Desk Patch, First Flight, Cyber Express, Jyoti, Skylark Express, Inland, Dolphin, Trackon Etc.
dear sir/madam: i just want to know fully details of this mobile numbers: 9997907938. it\'s a dehradun mobile no. but i want to know adress full details. please send me it\'s argent. Thanx.
Micheria said:
Thanks alot! I was trying to figure that out for my job project.
Hi
I can\'t 100% Agree the comments from these guys. I am doing business with spaceforhost for last 5 yrs.All are complaining regarding data loss in spaceforhost server. Sometimes it happen But as a serious customer we should atleast maintain our website backup.
But for customer support it is true , The customer support team is not thechnically sound. And in sundays tre is no online customer support and nobody will take phone.
Rgds
sreejith Nair
nooshin said:
I have been trying to reduce size of desktop icons for last two days, until I found your site and your help was great. Thank you
Vicki said:
I have an LG Rumor phone from Sprint that my daughter is giving me and I want to change to AT&T but I can\'t get the IMEI code. She has already transfered her service to AT&T so her Sprint account is closed and when I type in *#06# on the keyboard I get nothing. Any ideas?
Well the same thing I had trouble with and then suddenly the light came on ..Its so easy
Open google and go to prefernces and check the area you do not want to save search information the click on save preferences ...works every time. will also work in fire fox
jaxon dons said:
Great post. But I would like to say I have been really disappointed with Enterprise lately. While I applaud their green efforts, I will not use their abuse of taxpayer money by playing victim for bailouts. The Wall Street Journal did a expose. You can read about it here:
You have to pay to get the full Wall Street Journal article.
Jogi said:
pls try browsing http://coai.in/docs/ and look for file MSC Codes Jan09.xls...it is up-to-date...I tracked a twerp who used to disturb with blank calls...
found out - indiatrace.com - take a look.. Very similar..to help trace mobile numbers location on india plus many more traces like vehicle... http://www.indiatrace.com checked out and found Reliance GSM info also ..quiet updated..
My experience with Blue Dart was horriable!
I got my ATM Pin no after 30 days .. and thats too after banging with these people(both end) for a week. They dont give a damn shit ..all they care is about thier business...
Whatever, i feel all the Courier services are the same when it comes to north eastern states..
Some of theme even dont have a center ..
Mahendra Singh said:
Dear and Respected Amir Khan ji,
Namaste !
I want to write you. Please send me your correspondence address on my email address :- ms.jaipur76@gmail.com. I hope whatever I write to you, you will read and consider.
daddy. . . is the best. . . .aamir hussain khan. . .iam in indonesia daddy. .i love you daddy aamir . . .by maulam yusuf
Paul said:
I tried that but on my version of IW which is 7.0.5730.13 that option doesn\'t work. I went back and typed in the first letter of any number of characters... a, b, g etc. Several suggestions followed. One thing I will try is closing the window and rebooting. Maybe that will help but if not then ideas need to be updted here with more current information as I followed going through previous suggestions and in MY version of IE there is no option to clear forms in the way suggested.
hello sir amir khan how are you? my brother like you so much ........he is your big fan.
I NEED YOUR HELP SIR
kindly please sir contact me .......i shall be very thankful to you .
i will wait for your reply....
(YA ALI MADAN)
thanks
fatima
J Busch said:
THANK YOU.
It's been driving me crazy, the default icon size in VISTA takes up to much desktop real estate. Thank you for the solution.
nalina said:
i want the name of the person & detailed address of the mobile no. 9820808598 please help me
kumbe ilirian said:
i dont un comment
TJ said:
Wow...I am so glad I googled this. Thanks for the tip. I spent 2 hours trying to find the feature in Excel. Will use keyboard tips in the future.
Michael said:
I was able to fix the problem.
I had the same problem after removing Windows Live Mail.
For some reasons, I could not get the .eml files to open with Outlook Express.
I followed the steps in the Microsoft article KB 312355 to run the Msimn executable file with the / reg option.
Make sure that when you click on START, then RUN and you type
"msimn / reg" make sure you leave a space after the word msimn and the / and also a space before you type reg.
This will open Outlook Express.
Second step, go to My computer, Folder Options, etc.... and in the registered files type, select EML click change, you will now select a new Outlook Express icon - and the problem will be fixed.
Brajeshwar - Thanks for the info :). I will add these domain names to the list.
G M said:
nice car. i have one 2. share your experience so far with me.
Adrija said:
Please try to download some software like AVSVideo converter or OJOSoft video converter.
Nimish Bhardwaj said:
Hey Mr.Amir Khan,
I m die hard fan of you.You as an actor is fantabulous.But as a human being you also fantabulous. ur acting perfaction is so good. i saw gajani wonderfulllllllllllll acting.I m watching ur movies frm my child hood.....I think u creats ur own expectations n critarea....You look dam gud in 8 pack abs......Plz suggest me how can i got these abs n consentration which u have..............Plz tell Gud bye n take care......
Nimish Bhardwaj
AkstheAce said:
Thanx buddy ..it was really helpful
aejaz khot said:
Hi daer amir aejaz from mumbai here how ARE you what about your next movie?????? please contact me
Dan Barlow said:
As per the comments above I\'d tried and failed many times to reduce the icon sizes and accepted that it was an unchangeable constant not unlike the new Office Ribbon feature which is classed as an \'improvement\'.
Thanks for the advice on icon sizing. If you figure out a crafty way of replacing the ribbon with a classic mode I\'d be grateful...and so would the rest of my office!!
Dan
lisa said:
Hey i Love Your Car and it looks More nice and i Think your car is one of the Good Once But just take some advise give it a good and nice rims
Qasim said:
Thanks a lot, it came as first result of google :). Thanks a lot again!!!!!!!!
ashutosh anand said:
I was supposed receive my consignment which include pan card on 4th july 09 but I have not received it. When I tracked the consignment it showed pending due to insufficient address . I don\\\'t know how it happened ,I have been receiving letters/documents at this address since 5 yrs.
First flight service is really worst. I am fear if I use this service in future.
My consignment no. ZB1926425
maddy said:
is there any site to get name of the person . pls do the needful.send me to my email id
salaam,
sir ji
very good morning,i would like too work with u if think i can work with, your the super hero from my view you r super star of this bollywwod you r intelgent person in this indutries, n a good produces n actor of this india bolywood sir if u give me a chance to work under your guideance i would like to work in front or behind the sceren as u like .....
i give details of my self
name vikram singh
age 32yrs
phone no 9699526024
i would love 2 work with u if u give chance 2 work with .......thanking u vikrammmmmm
Instead of manually identifying the mobile code on COAI excel sheet, why dont u try \\\"Visual Mobile Number Locator\\\" in www.ezrecharge.in.
And it supposed to be based on COAI\\\'s MSC codes only.
Can you imagine just how many people have been helped by this such a simple and single explanation. Not every one replies with a Thank you post. Wonder if Microsoft\'s complex minds would someday provide answers in such a straight way instead of going through 7 or 8 wizzard steps.
Bruce said:
Thanks for the info. However it sounds like at the end of this you would need to pay Melbourne IT $35 a year to retain the domain name, versus $15 to Microsoft. Am I missing something? Is it not possible to simply tell a new hosting provider the domain name and registration key? (And then pay their annual renewal fee, if any.)
Good question. I did exactly what you mentioned in your comments. I transferred my domain name from MelbourneIT to GoDaddy, where it costs $8 to $9 per year.
Note: The Domain Registration Key (DRK) provided initially is different from the Domain Name password required later during domain name transfer. MelbourneIT calls it Domain Name Password/authinfo (see step 19 below) while GoDaddy calls it an Authorization Code.
Thanks,
Bobby
Paul said:
Micro$oft help was pretty useless (online and offline). Wth Bobby, 4 years down the line your blog is STILL helpin folks! Now THAT\'S a good reason for keeping the internet free
RAVINDRA NATH said:
First flight courier fool courier. I sent DEEPAWALI\'S GIFT.
through first flight on 14-oct-2009 from INDORE(m.p) to
BHOPAL(m.p). they told that courier will NOT deliver because
the address mentioned the gift box
is RONG ADDRESS
I called all offices/call center of first flight but
they are very irresponsible.everybody was telling oposite party pls collect the box.because its too many rush.
this courier is BAKWASSSSSSSSSSSSSSSSSSS.........courier SERVICE.
Aaron said:
Thanks, this is a very helpful tip.
Fred Smiley said:
The link you have given is not working (http://www.relianceinfo.com/webapp/Infocomm/jsp/nochange/YourNewNumber.jsp.
You Missed the latest videos,audio,cummunity,news website www.ManipurTV.com
Vipin said:
I also want to share my bad experience from First flight couriers. I had ordered something from ebay.com and the seller had shipped the item on same day. Next day itself it arraived in bangalore and the web tracking status was showing as \'HOUSE LOCKED\'. But, the whole day my wife was avaialble in house and when i asked at the security gate, they told that nobody came from First Flight couriers. Nobody was picking the call at the customer care desk when i called(for 2 days) and finally someone answered at a branch in bangalore and told that it would be in some other branch. But there again , the land line was SWITCHED OFF. I wonder what do these people do at this pathetic organisation? People dont pick call, delivery man never calls and dont even come to address and says \'HOUSE LOCKED\'. dEAR FRIEDS....Avoid this horrible and terrible service....in fact no service...They call themselves international.... Even local courier services do better job....
Happy Dude said:
WOHOO!!
Thank ye so much!
Dinesh said:
I need to appreciate the work done.... this is helping me a lot...
Vikas said:
Hello,
I am trying to trace the details for the number 9538021791. Could anybody please help me?
Check Out www.vivaconnect.in its pretty useful in sending free as well as paid sms to all networks including reliance..
sid said:
i need to trace a cell no. vodafone mumbai .... can anyone help me
Nvrijn said:
My hero!
Ram said:
One of teh worst courier service in hyderabd. first they dont know how to answer a phone call, 2nd : they answer the calls but dont speak, 3rd they disconnect the lines. i tried reaching the number : 040-32561070 reg to a Cargo delivery and this is the response that i receive. wonder in what shape would the goods be coming in.
CERTAINLY WOULDNT RECOMMEND THIS COURIER SERVICE TO ANYONE
Sejal said:
Hi Aamir......
I love you. I like your all the movies. One of them Dil Chahta Hain is my favourite movie. I like your acting, dancing , different different hair style and specially your look in Ghajani.
I m fida on your smile. I will wait for your reply... so plz
sandeep said:
thanks for your information .the stuff really works
Sejal said:
Hi Aamir....
I regularly visit your site becoz I like to know more & more about you. I would like to know about your life style. Aamir... you have dashing personality.You know..my biggest dream is to meet you once in life. So you can only fulfill my this dream. Plz...I will wait for your reply.
Sejal said:
Hi Aamir....
I regularly visit your site becoz I like to know more & more about you. I would like to know about your life style. Aamir... you have dashing personality.You know..my biggest dream is to meet you once in life. So you can only fulfill my this dream. Plz...I will wait for your reply.
It works for even 8 series mobile numbers.. You can track latest mobile and landline numbers here..
Really cool website..
Lucy said:
Thanks so much. I\'m using a Mac (and fairly new to it) and couldn\'t figure it out for the life of me!
Mansour said:
woowwwww.........thank yoooo
it is great, I have been looking and asking how to do it...yoo cool dude
riyan said:
thanks very much guys, it was very annoying!!!
Josh said:
Thanks for the info. I have been with officelive for several years now and have not been happy. I have lost the ability to access my accounts several times, each reaching up to three weeks per incident with TERRIBLE customer support. I had even offered them money to fix the issues at one point and was refused unless I wanted to sign up for additional services.
I want to transfer my domain from officelive to Godaddy and take back control of our domain. Your article mentioned that once the account is cancelled, all data will be lost. Since I have multiple employees email accounts associated with officelive, and their emails a vital part of our business, is there a way to save all of the emails for each account somewhere locally before the cancellation so that we can retain the past years worth of emails?
Thanks again.
veda said:
i changed it to classic
still i am not able to reduce the size of the icon
Equebal Ahmad said:
I think now focus should be on the solution.Can someone provide the details what sort of action can be taken against these offenders.I believe consumer court may be one option.
Fonzy said:
Man Oh Man...
You know, there is Microsoft (with their online help blabla) and there is you (one line is worth more than ... whatever!!! you know what I mean)...
THANK YOU MAN
sveta said:
Nothing works, may we have new links?
Shravanti said:
hello aamir ji
am die hard fan of urs..since childhood i admire u..cos u look so cute when i was child..n now in short U ROCKKKKKKKKKKKKKK. i was looikn forward U vth Kareena.. n now even dt has come true..am so exited about ur movie 3 idiots..i wud like to talk to u personaly...if u have at least 10 mins time pls reply to my mail id...shravanti.chowdary@gmail.com
keep going...
love u
shravanti
Leonard said:
This is the best info that I found on THIS SUBJECT. To those who cannot access the \"Clear Search History\" link on your Google search drop-down box, this is a solution that worked for me. I, too, could not access the link because my search history was so long.
In the search box, I typed in ONE letter and waited for \"suggested searches\" to pop up. That is usually a short list, and at the bottom of the suggested list is the \"Clear Search History\" link. Voila! Hope it works for you as it did for me.
Trisha.B said:
THAT was so easy..Thnk you.......BUT !!! I have other problems now.....I downloaded the updates for Vista as per Microsoft...and WOW everything grew so big.......I run Vista the first edition and was never told it was the BETA version !! what a mess I paid $3,600 for a heap of garbage.....HP Pavillion 7000..it crashed the second day.........and has been a problem ever since from hinge breaking to corner of the facia snapping off......and continual crashing.....HP said nothing they can do its the Beta version...???now this........if it crashes we are supposed to go into the start menu and hit RECOVERY...Ha !!!! thats ok if you can get into the start menu.......ohh well
I would so appreciate it if you could help me get everything else back to normal size.......with your wonderful help I have reduced the size of the icons ....but task bar and everything else is extra large........have tried every means know so far to reduce things down........nothing works....
PLEASE HELP ME.....and you\'ll have a friend for life....
www.FaceMaza.com is a place to create and share fun.
Make fun with faces like indian film celebrities, bollywood, kollywood actors & actress, Indian cricket players & sports celebrities, and with other comics super heros like Batman, He-man, Shrek, Teletubbies, Mickey mouse.
You can download customized images to PC, send to your friends, post/embed in social network sites like Orkut, Facebook etc.,
Using FaceMaza.com, you can…
1) Create and send facecards featuring your face in happy occasions like Christmas, New year and other seasonal festivals
2) Create and send facecards featuring your face in film stars/celebrities outfits
3) Get photograph with bride/bridegroom outfits
4) Get photograph with Indian traditional dance/art like Bharatanatyam, Kathakali etc.,
5) Put your face in WWF stars with six-pack body
6) Put you face in cute cartoon / comics character’s body
Create, share and delight your friends and family using www.FaceMaza.com
N SRINATH said:
Dear Mr AAmir Khan,
I am srinath from Hyderabad working with Axis Bank Ltd as Manager , I want small help from you , i request you to please call me over my mobile 09849664193 , talking to you over the phone is my Life\'s dream , pls call me once , i will be more happy .
I hope you will call me once........
N Srinath, Manager , Axis Bank Ltd
Regional Team , Secunderabad
Hyderabad.
ALL IS WELL
Anna said:
Leonard,you are a genius.Why are the most simple solutions the most difficult to find? The answer is so obvious when you know and you really wonder why you didn\'t think of it yourself,thanks.
KRISH said:
IS THERE ANY CHANCE TO KNOW THE DETAILS OF THE MOBILE NO. I AM TRYING TO TRACE THE DETAILS OF THIS NO.: 9491962092. BUT I AM NOT ABLE TO KNOW THE DETAILS. CAN U PROVIDE THE DETAILS OF THE BELOW NO.OTHER ALTERNATE NO.'S R WHO IS THAT PERSON WHICH PLACE ETC.....
Usman said:
Great job done...
You blog is 5 years old and still very helpful.
Thanks.
Abdiel said:
Thanks bob. That helps a lot.
Shan said:
Wow,. This is a time saver for me! :D
ANIL SHARMA said:
if i found you in front of me AMIR i will kill you sorry to say
this the full film in 3 idiots i have cried so much i have a
chest pain now and i have already seen the movie more then 30
times now you are too good Amir i am at your age only that's why i
am calling you Amir but now i love to call you Amir Sir you are
the best love you while sending you this comments i am still
crying i can stop doing that what kind of feeling i am having
after seen your so much of BALATKAR bhagwan kare aap ka ghar
STAAN SE BHAR DE aap ko kabhi bhi STAAN KI KAMI NA HO baki aap se
bada BALATKARI koi nahi hai meri najar main love you buddy best
wishes for your new BALATKAR
hi aamir, ilike u very much .recentaly the whole world had watched ur super movie 3 idiot really u r great .actually sir i want to meet u but i do not know how? SIR AGAR BY CHANCE BHOOLEY BHATKE MERE IS COMENT PAR NAZAR PAD JAYE TO MAI AAPKO KEreal script dena chati hu aur mujhe yakeen hai ki usko aap aisa innovative tarike se laoge ki log dekhte reh jayenge afterall u r perfectionist .hai na par shayad aisa na ho kyunki aap se milna ya aap tak pahuchna waise hi hai jaise subhah uthkar ishwar se baat karna ki wo hai aur meri baat sunega shayad aap bhi sun lo ..........hope for the best god is great
Thank you so much for sharing how to reduce the desktop icons. I as well spend hours, days trying to reduce the size of the icons, they were driviing me nuts.
David said:
Thank you! The computer techs at Office Depot did not know how to reduce the size of the icons. Glad I found your blog!
DIVYA SAMAD said:
I think this SMS to Reliance mobile phones. - Bobby Maisnam -- Blog got really sweet things.
I mostly love this one www.jokesmsquote.com
Thanks, this worked for me…but in a roundabout way…I was just ggetting 500 errors on my modules page,when it wouldn’t load.
santu said:
I got couple of sms from a number which starts from 80111
Do you guys have any idea about the number?
vinay bhatia said:
hiii aamir
this is vinay bhatia from shimla, i am ur big fan and i want to share something with you, i have a movie script based on the real issues suffered by youngsters like us . this script is basically based on casteism,love,passion. i know that you would definately like it. sir seriously i need your support. contact me at 09736224792
Dear sir Aamir Khan i have seen all of your films and iam the assistant director in dramas in a production house i loved you very much but after watching 3 idiots i liks and respect your spirit in movies and your expression are very strog which is requore in the movies and theatres do more efforts like these.
Znuter said:
haha lol.
Thanks from me too :)_
lipolkguy said:
Thanks, you are the man!!
teejay said:
it was exactly what i wanted. thank u very much
panos said:
Thankzzz
PottyBoy said:
Thank you so much for the tip!
Tried both Ctrl+Enter and Shift+Enter but not Alt+Enter. :0
www.manipurtv.com is fantastic and i kinda loving to it by watching videos, songs and looking at pics.. and i really thanks to the owner of ManipurTV.com I hope more interesting sites coming up soon
Peter said:
I added a lot of software recently and was starting to get annoyed by the clutter. Thanks!!
Jackov said:
5 years later and it\'s still a sweet tip!
tabrej shaikh said:
i have best story/script for you
kindly contact me 9223190416
9892615132
hi amir many many happy returns of the days...... all th citizens of india are really previlaged to have a wonderful actor like u among overselfs..............
hey nice post,i tried sending sms on cdma network but no messages are sent,and can you tell me how can i send sms from yahoo messenger on TATA and RELIANCE numbers because whenever i send sms on these no. msg is displayed that \"messages cannot be sent on this number or number is incorrect\"
And thanks for this information.
I had a basic HP inkjet printer but the ink always seemed to dry up before I could use the whole cartridge. And I have often felt the need to scan or print something at home. I don\'t think I will be using the fax option that much though.
SMS to reliance mobile phones through shared short code is introduced by a US Company Txtimpact. It allow to send sms from web or pc to all cellular networks using 5 or 6 digit short code. This shortcode is easy to remember and also your customer easily send sms to your server with request of products of features. see also http://www.txtimpact.com/shared-shortcode.asp
DNSRight said:
DNS tools have a few free tools to check if your mail server is blacklisted.Network and Free DNS tools. Check smtp mail server blacklists, run port scans, Trace route, NS Lookup, Dig, MX test, CNAME lookup, port scan,Online DNS Tools,Open Port Scan,Free DNS Software.collection of free DNS tools for troubleshooting, testing, checking.
Thank you! I tried Shift and Ctrl and Enter and Alt, but not alt+enter.
Jess said:
you rock!! thankyou! I\'ve never tried alt, only shift.
Nadir said:
Life saver!
Thanks :)
Varadha said:
It crashes the ego when we all think that we know a lot in Excel. Even after 5 years of this post, this comes as the first thing when googled. Though I had only came across such a need today, your blog helped me not to spend too much time to figure it out. Great....Thanks a ton....
Md Naushd Alam said:
Hello Sir,
This is Md Naushad Alam from NEPAL but right now im in Bangalore for my higher education, Actually sir this is my first time so if u will get any mistake then forgive me, by the way im crazy about your mind and ur decision, the way of ur taking decision really i get surprise. By the way when i see ur movie then one thing i must get that u have very much passion and u are the one of the best person in the world who makes crazy to the audience by giving wonderful job in the movie............
actually i always wait for ur new movie and i get diffent knowlegde and different passion from ur movie and by the way \'sir\' i want to be in contact with you because ur my ideal person and i learnt many things from ur life by reading ur biography and i got many things changed in my life by following u.....so please sir its my request that please reply me. if u will reply then nothing will change in ur life but Obviously i will get many changes by watching ur message that my idol person replied me a message.....actually i will be very happy and there will be no bound of my happiness...thank u.......
by the way my email id:-(naushadalam.passion4sse68@gmail.com)
dani said:
Thank YOU! been trying to figure it out for months!
hi amir khan i like u and ur movies so ur best pics is big hair of mangal pande movie buy buy khuda hafiz ......?
Adomas said:
Thank you thank you thank you thank you!!!!
rome ma said:
Thanks Dude
Bhavesh Shah said:
First Flight couriers have the worst delivery than any of the couriers that i have ever experienced. If anybody misses one shipment the task to locate that is a very big one....even in a city like mumbai......Customer Service sucks...half the phone numbers are bunk and other half are always in switched off or busy....and when you manage to get one cc exec he / she is compleletly lost.....
This is why hummankind created the World Wide Web. Excel Help was useless but Bobby Maisnam is a deep hero (and a hat tip to the other Andy with the Macintosh tip). Now we can go back to our creative lives and love.
Jim said:
Thanks! You helped out a marketing dept in Lake Forest, CA!
You go dude.
leena pesswani said:
I sent the courier throgh first flight on 28th of september to pune ( Symbiosis) to send my registration form for PGDHRDM and the last date for registration is on 30th of september. The guy told me that it will reach at pine on 30th september in morning, so I came online to check the status of my courier that it has been succesfully reached or not, but the website of first flight is very confusing and dnt know where to chcek the status and when I called the customer service department then they do not have answer. Now god knows my courier will reach there in time or I will be left for addmision till next year. Please its my humble request to the managment tem that improve your services. Couriers are to deliver the things in time and there is no use of couriers to send if things are not deivered in time!!!!!!!!
I am still having problems with DTMF & Skype - do you think these are related to sound card issues eg introducing distortion?
Ravi said:
Thanks Dude
For Open office users ...
In Open Office Org Calc,
Ctrl+Enter : to enter new line in a cell
:)
Cheers..
Brijesh said:
The first flight courier is the worst courier service i have ever seen in my life. No timely delivery, no updated status. even nobody will receive the call if you try to contact them. Better choose ordinary post over it.
Awesome! Still useful more than 5 years after posting.
Chris said:
Just googled this and you're answer came straight up. Awesome, Thankyou!
Tria said:
ok wow u guys are soooooo jealous.....as for the picture with her \"brown\" eyes, it was from a movie where she had to wear brown contacts!!! Before making an arguement, u might have to check sources. Where does it possibly say that she got plastic surgery? Did u look it up? Did u find sources?? That\'s kind of like me saying that every single cheerleader in america is slut (totally made up). Indians have an accent, duh! So does EVERY SINGLE NON-AMERICAN!!! It\'s not like she was born here! Stop being haters!!! She was a Miss World....the judges knew what they were doing....so stop pretending u know every single thing about her....losers
zohaib said:
thanx
meitei said:
I\'ve been looking about manipur in google and I found e-pao.net on top, follow by maniputv.com in second, kanglaonline.com. in third. Is there any website for telephone numbers for manipur
@meitei: Good point meitei. e-pao and kanglaonline are definitely the top websites about Manipur. However, please note that this list is based on when the domain names for the websites were first registered and not the popularity/google ranking of the websites.
Regarding your question about telephone numbers for manipur, I know www.meyamgi.com was a good resource but looks like the original owner did not renew the domain name and instead there is a placeholder page now.
Thank you, thank you, thank you. Have been looking for a solution to very large icons on the desktop and then, disappearing icons on the desktop for ove two months...
JOSH BROWN said:
Thanks for the tip it just saved my job lol.
Avinash said:
i am using reliance gsm prepaid mobile. Whenever i go for setup my mobile No. for yahoo messenger then i get reply that,We are unable to support the number that you have provided at this time why?
GrahamO said:
Bloody amazing. This has been a bug for me for many years. Good on Google. Many thanks
Hey thanks for the shoutout! We are glad you like us. We hope we can continue to be the service provider you use to make your international calls.
Autumn
Lim said:
I am selling the bird nest primary products
It from Malaysia and Indonesia
These product is before going thru and chemical wash
It is purely organic
Interested please contact me
Zul nine said:
Thanks for the tip. Keep up the good work.
John Mc said:
2011 and it still exist, but gmail now says \"Sorry, you can\'t create a label named \"important\" (it\'s a reserved system label). Please try another name:\"
Ted said:
Thanks, have been looking all over.
Elshinette said:
Can you please help me track my cellphone with my IMEI number?
My IMEI number: 358027035482976
Jansen said:
The sequence has the "*" missing: It should be "*#06#".
ofenby said:
Thanks for adding the Mac instruction. Been looking for this everywhere!!!
Pete said:
Hallelujah! A thousand thanks!
Mary said:
From 'Down Under' : love ya
Galina said:
Aamir, You - a brilliant actor!
aaslam said:
Thanks lot bobby, from 2005 onwards still your post looking very young...long way to go....cheersup
ika said:
if she is not intelligent and beautiful why she is chosen as miss world? you think the judges are stupid to choose someone who is fake? if you find her dumb then the judges who selected her in the event were also dumb. I found her to be smart and witty in the interview.she is just happy and excited.i would admit there is some of cultural gap between the two and others who seem not to know what is the reality outside their world.for me it is a very interesting, intellectual and humorous conversation and of course we need brains and good sense of humour to interpret it in a positive manner.
Vijay said:
Excellent!!! it definitely made my day.
thanks Bobby
Archangel said:
thank you so much for sharing this very helpful info. it really helped me since i just had a reboot on my laptop and icons returned big over my desktop. thank you again for the wonderful tips.
Hi aamir Bhai!
I am from pakistan. and want to talk to you on phone. plz give me number. if you cannot then here is my number. 0992346-5682959 Only one minute call can be the finest moment for me.
Regards
Aamir Shahzad
Pakistan
Nancy said:
Thanks much Bobby!
Fred said:
I first learned how to do this years ago, but hadn't had a chance to use it so I promptly forgot. Thanks for refreshing my memory.
Marcella Rorbacher Malatka said:
On March 3, 2011, I purchased the LivingSocial Fandango deal for two movie tickets posted by Bobby Maisnam. The only thing I ever received was a thank you email telling me that within 48 hours I would receive an email from the LivingSocial Team with a Promo Code and redemption instructions. I did NOT receive the Promo code or redemption instructions. How do I get what is needed to have the two tickets I paid for.
Looks like you bought the deal on time i.e. before they expired.
- Did you look at your "my deals" page after logging in to your LivingSocial account? Mine shows up there. You can click on "view promo code" to get the Fandango code.
- You can also click on the following link (https://livingsocial.com/fandango_promo_code) after logging into your LivingSocial account.
If you still have problems, please contact LivingSocial directly (https://help.livingsocial.com/ > Request Support). I am just another user :|
- Bobby
Jon said:
In order to get your promo code for the fandango movie tickets you purchased at the living social app. You must log in to the original living social website, not the mobile app. version and log in into ur account. Look for your purchases. Click on the fandango purchase and it will give you the promo code. It will tell you to enter your e-mail address and it will send you a confirmation receipt. Hope you\'re able to redeem your tickets, enjoy.
Search
About this Entry
This page contains a single entry by published on February 4, 2012 4:01 PM.
Find recent content on the main index or look in the archives to find all content.
Comment Testing.
If I click try to post a comment from the main page, then some of the page contents are not seen. Pretty Strange.
Maybe some problem with the stylesheet.
Entering comment from elangbam.com. I guess an error might be generated.
btw, just got a blank call. dunno who called up at 4:39 am in the morning!
Thanks for the links you provided on this page. The Kazaa ones where exactly what I was looking for. I also have a DI-614+, but I don't use it for web access as it's rather a poor router. I have instead installed a DSL modem in one of our servers and share the connection through that. The set-up works quite well, although it does leave an over-qualified router twiddling its thumbs :)
email tom at debees dot com
Hi Bobby!
Do you remember me?
Anoushka Shankar is really a great player of Sitar. I have heard her playing with her father on T.V.
Anyways, how are you doing?
how did u manage to send sms to reliance...frm web???is there any website..whcih offer FREE service???dont tell me abt smscountry.com or other whihc have paid service..
It doesnt' surprise me that allheadlinenews.com would offersomething like this considering that they look like the're doing alot with rss.
I hope you can direct me..
My XP crashed.. BUT, the machine keeps on looping. It’s so fast, I know I have a BSOD, BUT it’s a flash and I can not stop it to se the error. Then it starts again and again. I tried the safe mode, last known good config, but it loops again and again. Can’t stop it unless I shut off the PC.
Any direction would be great. You see, I’m not sure the OS is doing this, What I mean, I installed a new driver for IDE controller (VIA) and noticed I started having problems.
I can get into the BIOS but since the unit will not boot into the OS, I can not get to the device manager.
I truly thank you in advance for any and all help/direction you can give me.
Mr. Angel Marrero
NY.
Yes there's a portal www.indiasms.com wherein u can send free sms to any GSM/CDMA or SMS enabled Landline Telephone Number in India.
The site is soft launched and may not be available for some times
infact net4india is also good and we can send sms on any gsm / cdma mobile phones. They provide one sms free after registration
Hi there..
therez another site http://www.FunOnPhone.com that provides SMS to Reliance India Mobile Phones.
Rgds,
Nikhil
test comment
http://www.smsjunction.com : Send Free SMS messages to India.
Congrats:-)
hi guys,
indiasms.com does not work & funonphone.com is not fair. you need to send sms in a specific time period, otherwise your balance expires. they are cheats...dont use their site!!!
how to send sms from web to reliance mobile
How to send sms fromthe web to Reliance India Mobile in bangalore for free....
I found some pictures of anoushka from very early life very interesting
http://www.geocities.com/narendrakotiyan
Hey Bob,
Being an uncle is great. You know, i'm already an uncle for 10 kids already in the age of 24!!! And am expecting a new entry in the next month. How about that mate???
Regards,
Jo.
That friend has a bloody name !
Nice site. Keep up the good work. Bryian
funonphone.com is a cheater who says sms free but after registration says you can buy recharge vouchers as well as smstoindia.com is also not a good service which allows only three free sms and then they charge for more sms and even those three sms which i sent has not received by the respective mobile users
www.smscountry.com is a waste site
Hi All
Well it is a good news for Rediffmail account Holders Free " 1 GB " Mail Space, fine some people says it is crazy but its nesscary to have Huge
E mail space just two days back i read even Hotmail and also Yahoo they are joining this War.
Ecept krify sms i didnt see any reliable sms sending through web, all the site smscountry, smsindia or rediff are bull shit dont use them
but krify gives only limited service but yet reliable that too for free
How to send email from the web to Reliance India Mobile in Goa for free....
hi bob,
i was surprised by your june 23 entry:) i never expect you will mention my birthday in your blog...
anyway thanks for the greetings...
do take care bobby the great:):):)
mai
/ ps. i read ur comments on my june 22 blog entry;);)/
hi what network mobile is +91 135 .......? Is 135 a reliance mobile phone? my friend reside at Dehradhun, what cellular network are providing there? Do you have any knowledge what website for free sms for this network please let me know i need it badly
FUNONPHONE.COM is cheat..they dont provide srvice as they offer...Dont waste ur time by visting and registering urself...WASTE!!!
how to send sms via computer to reliance mobile what is ths cell address we have to type
Hello i am regular visitor of smstoindia.com the service is very good and fast i dont agree with the posting of Mr.Prashant bcoz i am a paid user the smss which i have sent including Reliance mobiles all have reached the destination if the sms did not reach means its simply the problem with the mobile number entered thats all ..
Hi !!
Can we send free SMS through PC on mobille or landline connection of AIRTEL Madhya pradesh?
If yes, can anyone please pass me the link.
Thanks
See guys, funonphone.com is a very nice site but they have now limited to 5 msgs per day. so i dont say its not reliable. go register and enjoy the fun of sendin atleast 5 free sms msgs per day to your loved and dear ones.
How to send sms from the web to Reliance India Mobile in Maharashtra for free....
How can i send free sms to reliance mobile
Use MTBlacklist from
http://www.jayallen.org/comment_spam/
And here is my blacklist
http://brajeshwar.com/mt-static/blacklist.txt
Import that, you will be protected from over 4,000 url fragments. I use to receive over 200+ blog spams recently and now it trickled to about 3-5 which I can manage after installing MTBlacklist.
Or Best switch to Movable Type 3.0 (that is what I am doing soon)
i live in canada and figured out a way to send sms to reliance phones in patna is thru email address- for example it will be "916120000000@ri.irisme.net"
i have been doing it for alst 6 months and it works.but u have to save the whole address as a email address in ur sim memory.
if all of u guys succeed - send me a letter of thanks- raj
Hey Bob,
It's me Jo here. Hey - Suppose my URL is www.joplanet.com and I want to re-direct it to www.maisnam.com. Then how can we make it so that the URL in the address bar will stay www.joplanet.com through out the browsing, while the pages of www.maisnam.com shows up?
Regards,
Jo.
You forgot the link to the movie site.
http://www.thebournesupremacy.com/ right on your main entry.
Thanks Brajeshwar! Have added the link.
I have a reliance no: , and Id like to sms, to a US tmobile cell. Can anyone tell me the best way to do it.
how can i send sms to reliance mobile
I'm using ralianceindiacall calling card its good.If u reduce the rate 10 cents/minute anywhere in india that will be excellent when compare to another cards in the market.
I hate the mail in rebates from Best Buy. Thay have it on almost everything! It's such a pain to cut out the USP code and mail all the requested things
how can i send sms to reliance mobile
The last time I checked, it was
Members > Invite Members
and then you have the option to skip invitation and add directly.
And yes, the option is still there!
Well guyz, I just called reliance for help and they told me that the only way they know how to send sms to Reliance, India from the USA/UK is this way-
The sender has to send the SMS in this format ie, 91+stdcodewithoutzero+reliancenumber@ri.irisme.net
for eg. 91443108923@ri.irisme.net.
I'm sure what raj says is correct.
Hi guyz, well even i do faced problems with smstoindia, funonphone, indiasms and smschild.
My favourate is, www.Krifysms.com a decent service. Though they wont claim much blablas, of all the services Krify providing they are simply best. Its absolutely free service.
Yes, i do agree with above posts. The only internet web site i felt cofortable is http://www.krifysms.com/ their services are limited. but very much reliable.
Krify is the best site to send sms...i agree to this. but the problem is u cant send sms to RIM phones. Does anyone know who provides such service?
You can use the
91STDCode-without-0RelinancePhoneNumber@ri.irisme.net format to send the SMS to a Reliance phone..without issues. I do the same using a sprint phone. However while I cannot receive SMS from the RIM phone on Sprint..it does come through on ATT Wireless though...
Hi xdf,
I have a question.
Does this mean that emails to reliance phones (using the format 91+std+number@ri.irisme.net) can be sent only using a cell phone and not using a normal email account like yahoo or rediffmail?
I tried sending SMS from my email account (and not from my cell phone) using the format specified in the messages above. But the messages did not get through.
- Bobby
Surprisingly, expecting it to be a part of reliance owned website, when i see the whois record of the domain "irisme.net" i found it belong to Iris Wireless, USA.
Can someone comment on this ?
Bobby,
You are right about the emails from a computer - the messages to RIM seem to be delivered *only* if they originate from a mobile phone using the 91...@ri.irisme.net format.
Does anyone here receive SMS from Reliance on their mobiles? If so what carrier? The only carrier in the US that I know of, so far, on which RIM SMS is successful is ATT...
On a tangent...the interesting things is Reliance advertises on their website that they can send the msgs to Sprint, but Sprint says that they do not have any such agreement. In fact, one of Reliance techie reps confirmed to my contact in India that a msg that was sent to my sprint phone from RIM was "delivered" to Sprint however, I did not receive it here.
I am planning on giving up on Sprint and switching to ATT so that I can receive SMS from my folks in India...
Sending sms using +91+countrycodewithoutzero+mobileno@ri.irisme.net does not work thru email.It works only if u send sms from mobile using this as email id.
No site except www.krify.com is good for sending sms, but the disadvantage of krify is that it does not support Reliance Network(CDMA). Its good only for GSM Networks.
Does anyone here know abt a sms gateway thru which we can write a program to send sms ??
funonphone.com is the most horrible site. infact the only person who gives good feedback about the site is its owner nikhil ;-) smart..isnt it?
i think smscountry is comparatively better than the rest of the sites in the same league.
Hi. I'm a ATT wireless customer and I receive SMS from Reliance phones in India.
I use my ATT phone to send SMS to frnds in India who have a reliance phone. but since yesterday (Aug 11th) I'm facing problems sending SMS to them. I get a notification that the message could not be delivered to the reliance email address 91+citycode+mobileno@ri.irisme.net.
Is anyone else experiencing the same problem?
Thank you.
hey sneha ,nikhil,rajesh,sanjay,xdf.- all you need to do is go to these companies websites and u can send free sms to the phones in us/canada/
for example if u go to sprint.com- u can click on link send sms and enter phone number, and ur done.
but if u guys donot have computer or web access, use email address like "irisme.net" from ur cell phone and though technically its not sms its email, but it reaches becos att/sprint are using cdma technology like reliance.
for example- for att in us its "areacode+number@attnet.com"
for sprint its "no+areacode@sprint.com"
about snehas question of "iris", they are service provider who offer it to anyone who wishes to use it. they are "info satellites" available for use commercially.
lemme know if u guys need any help from canada/usa.
how do i send sms to rim free
The web is another name for c****** as it is unable to send msgs. to reliance.
iam fareed here i wnna sms to reliance from pc
how to mail space 6 mb to 100 mb
relianceindiacall calling is the worst card i have ever used...Bad connection ....and if its connected quality is very low....can't hear anything.....
Myself and my wife have been using relianceindiacall post-paid for the past 2 months and we are really satisfied with the call quality and connection. It is the best service I have ever had.
Hi beaula,
Me and a couple of my friends have been using RelianceIndiaCall for almost 2 months now and the call quality has always been excellent. I have stopped buying other calling cards all together.
- Bobby
gyz ,, www.happytexting.com was xcellent site for sending sms ..but now it's not workin ..ne1 knows ,why? can v send sms to RIM thru it?
I really like this , it is the BEST on the market.
Hey guys .. cool.. i believe u all r frm US or Canda n u has CDMA phone over ther.. m frm Dubai n v got only GSM here.. once b4 2 months i recievd a msg frm a friend's reliance phone but i couldnt send reply 2 him.. it got failed.. now he s also not able 2 send me msgs ..ok.. so can anyone help me how 2 ve a sms or email contact wit reliance phones..
Just to let you know of another SEO contest going on right now, started in the UK but mainly being entered by french SEO enthusiasts
hey guys go to www.adheeth.com/sms.php and send sms it really works...
bye
loves manish
I live in india, kolkata. I cant send any sms through web to any RIM nos. refer me a site to send sms to any reliance nos. All the websites in this pages are of same backgrouds or even some of them are bullshits.
Try smsac.com to snd sms to indian nos for free.
but cant support reliance till now.
i want to know how to send free sms by computers on gsm & cdma mobile phones in india.
I have a t-mobile phone and I do receive SMS from RIM. I can also send SMS to RIM as 91+phone number@ri.irisme.net ...
Hi A,
I have a question. The RIM phone that you receive messages from, is it a prepaid one or a postpaid one? I can receive messages from postpaid RIM phones in India but not from prepaid RIM ones. My service provider is Cingular.
Thanks.
this is the best card i have ever seen.good connection and quality
hi there is no webs on net to send free sms to rim my exp.is about 2yrs old.thanks.if any told me drolga@rediffmail.com
hi/
may i get a gmail invitation please?? please mail me at joe_hot66@yahoo.com
i want to send a sms to relaiance phone but it ddnt work
hy my GF has a RIM now i don know what to do, really need to contact her.
if anyone has any info bout a site with free dervice to RIM pl let me know
thanks
sucker
Hi i was wondering if i could also have a link. I have been searching for a while now and 4000 link sover at kevinrose.com were snatched undermy nose within a couple seconds
Toddehmke @sbcglobal.net put it together seperated for spam bots
Hello everyone!
well this is my first posting in any forum, for all those people who are looking to send sms through internet to the mobile phones in india...try using http://www.mobilekarishma.com I bet u wont regret. It supports almost all the mobile operators operating in India, except Reliance where Reliance (kolkata) is the xception. And beside supporting the indian mobile operators it all also supports the operators of many different contries..counting from palestine to US...and you know what all that FREE OF COST!!!
Try it and if you like it do tell me by mailing on my e-mail!
Have a nice time to all!!
I have been ripped off by many name brand calling cards. relianceindiacall is best thing happen to me. I love using relianceindiacall card.
i want to send SMS from my computer to the mobile numbers of my friends staying in dubai ....the numbers starting 00971-
Please tell me how to go about???
Hi Everyone, I want to send FREE SMS to GSM & CDMA Reliance India Mobile with in India. I have tried many sites but not get satisfection. If SMS sent to reliance mobile phones using the format 91+std+number@ri.irisme.net from a mobile phone. The message will delivered & if sent from a site it will not. In this case I want to know what is the need to use this particular format to send SMS Cant we send it using mobile normaly. Or if we send using above format is it free even after sending by mobile. If YES please tell me How can i have to save the emeil in sim card of mobile phone.........
please help me.
hii frens !!!
greetings ? how r u all? well, this is my first post and i am hopeful someone wud be able to solve my problem. i live in india, bhubaneswar. i wish to send a pc to mobile free sms text msg to a reliance mobile handset in ahmedabad, gujarat (both places inside india only). plz help me ...if anyone can give me any useful website link or info ...it will be much appreciated. mail me the ans to itslopa@hotmail.com.
thanx and have a nice time.
hey guys if find any websites from which you can send sms to RELIANCE INDIA (GUJARAT) AHEMDABAD Pls Email me on nsp909@hotmail.com
thanks
i stay at b'lore,and if want to send sms to airtel kolkata i have a link http://net2cell.airtelworld.com/net2cell/jsp/default.jsp
test comment
how to send sms from web to BSNL mobile in utter pradesh east pls reply if any one have solutions
thanks
if any 1 wan'ts to know how to send free sms to reliance phones..mail me at verycute_poo@yahoo.co.in .... iknow the way.trust me!
hi, i m from australia and i cannot send sms to reliance in delhi. if any one knows how to send an sms via web please tell me. my address id singh_naveen2003@yahoo.com
Hi all !!!
if anyone wants to send Free SMS to any mobile in India including BSNL and Reliance just goto http://www.smstoindia.com its a site which offers free SMS to BSNL & Reliance i have tried it out its nice and usefull . i hope all you folks will like that site ..
bye
Kamal
T-Mobile phones can receive sms from RIMS...but I could not figure out how to save RIM phone # in the email format...I have Sony T-610 model
From the US : You can send sms to any reliance Mobile phone from any verizon wireless phone by sending sms to 01191+(citycode)+(number). works great you can also receive from india.
This is wonderful. It would be nice, if this can be avilable for 10c/MIN to India when compared to other providers.
Wonderful service, God Bless RelianceIndiaCall.
I was very tired with all kinds of calling cards, but now no more calling card, just Reliance, Reliance..
Thank you
Rajesh Makwana
Have been using Reliance India call for about three months now and the quality is good, but as mentioned by others, the rate should be lowered further to consider it as a price competitor to local providers like AT&T.
Reply to fromnh and T-Mobile Users.
If you recieve an SMS from Reliance Phone in India. It will come from a 3 digit number ranging from 300 >...
If you hit reply The message will go thru and if u have delivery notification enabled, you will also get a confirmation. But Remember you got to reply within 24-36 hours. The 3 digit number expires after that. It is a temporary fate way established by the operator when it recieves a message from reliance in the form 91YYXXXXXXXX@ri.irisme.net where YY is city code and XXXX is reliance number.
and no its not free, it gets cut from your quota of your messages! and why the fascination for FREE! pay some money to get peace of mind that your message is going thru!!
Dear Friends,
Instead of blaming the web and searching for sites, i feel we can curse dhirubhai ambani for fooling people in the dhirubhai ambani pioneer offer....they are huge cheats more then our indian govt. cheated the people of india in broad daylight hahaha. change ur mobile to gsm - airtel or hutch...for a better service and international acceptance
hi all
how to send sms to dubai from pc
pls tell me anybody
hi everyone try using www.FunTooZ.com for sending sms to Reliance CDMA in India. Though its a paid service but i don't 99paise is a burden on anyone to send sms. Works perfectly fine. FUnTooZ.com's gateways are the backbone of few above mentioned websites that give free or charge 1.49 Rs
(: Yes, they've moved and de-emphasized it :)
RelianceIndiacall is THE BEST. Here are few SUCKERS
1)Razacomm
2)9278
3)Ringmycountry
4)Indiacitycard
5)SDI card
6)Letsdial
Yes Bobs, I like that song too! They really rock!!! I have the MP3 playing in my PC everyday. The lyrics is also good. "i'm not a perfect person..."
I love that song too! :) And I love Hoobastank too :D Another song that is really great, (been my favorite for months..) is " What Happened To Us?". Abolutely asume..Listen to it! :D Just a piece of friendly advice..:) c ya
hi friends,
Do u think any web site may help us,with out,charging money,never,all they want to lead us to such a situation,If anybody practically know any site to send sms to BSNL kerala,pls advice properly,by ur experience only.
shaji
pls someone let me know how to send sms from pc to reliance mobile.
thanks
Relianceindia connection is good, but the quality is lousy (at least the place I'm dialing).
I would like one pleasssseeeee.
I have been waiting for gmail since google anounce it.
I want one pleaseee...
thanks....
email me at bgsince681@yahoo.com
Excellent connection quality. Reliance has lived up to it's name. A rate reduction from the current 11.9 cents/minute would go a long way in this continuing to be the "most preferred" service as competition seems to be catching up soon.
The beauty of MT 3.x is the file hierarchy but you have (I think) decided to keep the old system. I think MT 3.12 was released recently though I am still running the beta of MT 3.12 on my site.
Hmmm, and I realized that you have set the option to moderate comments but somehow your re-direction is not working that properly. Then why not activate TypeKey Authentication too.
its ok not bad
i can't get your website open
Hi,
So many people, somany comments, sooo many references, let me tell you something there is no such way (I mean direct) way to send an SMS from PC to reliance CDMA mobile phone. Yes the SMTP user is being created on the server when you have a reliance phone. (Please refer to www.network-tools.com select E-Mail validation option and enter the 91XXXXXXX@ri.irisme.net it is saying that the user is existing) and when I tried to send SMS message I am receiving that message. So there is something which we need to get through. Trying to get that information and the moment I'll get that I'll post the commecnt.
thank you and have a very great day everybody
Regards.
the best site to send Free sms to BSNL and Reliance is http://www.smstoindia.com
from here you can send SMS to any mobile in india .. no other site can claim this sites status..
i can bet on this ..
Regards,
Rahul
Hi Brajeshwar,
Thanks for your comments. I have activated TypeKey authentication. But it still requires comments to be approved even if they are from TypeKey authenticated members.
Also, I am still having the file permission problem (MT writes as 666 and so the server does not allow it. It has to be 644). I guess I will try upgrading to MT 3.12
Thanks,
- Bobby
I am not sure which courier does Rediff Shopping uses but they were fast and on time when I did some gift transfer twice.
Hi all...
so all u guys r hungry to send sms to Reliance India Mobile(RIM)..go to www.FunTooZ.com its really WorkS..On registration they will give 2 credits, so u can send 2 sms for free to RIM or GSM networks..rest u r smart enough...
Regards
AnKiT...
03463323128
I am using relince card it is very good conection
Keep this link handy for next time then, it will be here before it goes public or even before it appear on any firefox official site.
http://ftp36.newaol.com/pub/mozilla.org/firefox/releases/
You may alternatively hook to their live cvs so that you will always get the latest build but then, most of them are betas (I am sure you are not really interested in un-stable releases).
And for this kind of rush downloads, you can also try downloads.com or other public ftps which mirrors the same.
I got my copy few hours before it goes public, so it was fast and quick and I was waiting for the release on 1.0 already. Anyway, there was not much change from the 1.0 RC.
Brajeshwar,
Thanks for the tip. I will keep checking that link for updates.
- Bobby
Where can I find a blog software? Hmm.
Jeremy,
[1] If you have access to a webhosting account, you can use http://www.movabletype.org/
[2] If you would like to start blogging without worrying about how to set up your own blogging software, you can get a free account at http://www.blogger.com/
- Bobby
dear sir,
My name is Ranjith Raveendran and I have one RIM pripaid connection at Kerala Tirur and my mobile no is 0494 3699762. and now the phone is at my fathers hand and I am working at Bahrain and here I have a connection provided by the network Vadafone and my no is 00973 36408973.
And what I am meaning to know you that I can recive the messeges from my phone from kerala and what's the problum is when I send sms to my mobile no 0091 494 3699762 they can't recive the messages when I asked about this with vadofone office the told me that is the problum of RIM network can you pls help to solve this problum in 15 day if yes I will not disconnect my reliance conection if you are not clearing my problum I want to give up you connection and try to take any escotel connection with in two weeks if you are not accepting my complaints I have lot of friends with RIM connection with same problum I want to say them as I mean before. expecting your replay soon.
Thanking for you
Ranjith Raveendran
Ranjith,
Suggestion 1: If your vodaphone connection allows sending of email messages, you can try sending email to 914943699762@ri.irisme.net from your mobile. That might work.
Suggestion 2: Send SMS to your RIM phone in India using http://www.smscountry.com .Note: This is not free. It costs Rs. 1.49 per SMS. But I guess it is worth it. The service is pretty reliable. I have been using it since March 2004.
And I guess you are confused here :). I am not an employee of Reliance India nor do I have a RIM connection. I just happen to have friends and relatives in India who have RIM connections. I posted this entry in my blog to talk about my experiences regarding sending sms to RIM phones in India through the web. Since MT allows comments, this has become sort of a discussion forum.
Point is, posting your complaint here is of little use, I guess. Instead, you might try contacting the RIM customer service at http://www.relianceinfo.com/Infocomm/html/contactus/contactus.html
HTH,
- Bobby
you can send sms to airtel, hutch and others on yahoo messenger. just log in and there is sms icon with mobile phone just type your number and it will tell you if it can or cannot send sms. go here to see which operators services are supported http://in.mobile.yahoo.com/new/messenger/
how should i send sms in dubai coz my brother is htere please say me or send me thisprocudure please
i need your service. can u send me in my email address for your information. i am interesting your to india in gujarat at baroda
I'm Mohan Das, Admin of www.jalanidhi.com. I'm dealing with Spaceforhost for the past 3 years and their service and support are very good.
i want to send sms to bsnl number starting with 9422
I have been very pleased with "the customer service and quality of calls" provided by RelianceIndiaCall.Com and its people. KEEP THE GOOD QUALITY.
Some cards are coming on the horizon to compete with Reliance with 9 to 10 cents without any fees.
Have you checked their offers(Specially hidden charges, surtaxes and weekly fees)
Your Account summary for each customer is really great since it allows us to see whom we called.
Since TWO DAYS I have not been able to open your website (relianceindiacall.com)
Best Luck/ Happy New Year
Ashvin Bhatt
hey.. hi
i wud like to know how to send a free sms to dubai from ur pc..
i've been searchin for a free service since months...
if anyone gets any info.. pls mail me.. at baibee_babe17@yahoo.co.in
thx...
I have heard nothing but good things about Relianceindiacall.com
Some of my friends also report good results.
For a change, we can depend on a service that is offering quality service.
For those who lament about high price, let's be fair: You get what you pay for...!!
I don't mind high price (within reason) if the service is good and - I think this service deserves the present price level. Competitive forces will take care of the price.
I remember paying exhorbitant amount for poor quality service not too long ago. We have come a long way. Thanks to competition.
hi..CAN WE RECIEVE SMS FREE FROM AUSTRALIA TO INDIA RELAINCE PHONES??
It is the BEST card out of all the cards I have used since so long.But it would be even more wonderful if we can get more minutes.
Hi All, There is not site to send free SMS to reliance india mobile. I think reliance is a very poor operator among all the operator in india. I cant sell or change my phone if i am a user of RIM. Please tell me if anyone know how to send FREE sms on CDMA phone...
good thing are always remember.
The view of this site immediately introduced a train of ideas into my mind! Nice Site! You may visit my wonderful site!!! http://gamadzoba.com/ (see attentively).
hi all!!im' not sure of an sms to reliance mobile via pc but im' sure of FREE sms to any mobile in the world via ur hutch gprs enabled mobile phone!!This hack is tried with prepaid and postpaid,its under trial!!smses even to 8243,7337 and even 00971......... are also free.no charges.for details check my site out::www.kirankonathala.tk,some mobile hacks there!!byee
does ne one know 2 send free sms from airtel kolkata GPRS ENABLED PHONE(NOT MMS) .COULD BE THRU SOME SITE OR EMAIL.GUYS PLZ HELP
Want a gmail account. Pls send me at sbaguli@timberland.com
Here is my take on the Movie
http://brajeshwar.com/archives/2004/12/oceans_twelve.php
Don't be taken off my Hollywood movies using Indians/Indian Names these days; Remember the Indian Families in Matrix, Parvati in Harry Potter and the Prisoner of Azkaban, the importance of the Goan location in Bourne Supremacy, et al.
gmail pls
sms2india is not giving free sms to bsnl and reliance.. they are also cheating.. the rahul, who posted the comment saying that sms2india gives free sms to bsnls/rim is a cheater..
Let me know some of the workable free sms to mobile phone site to (1) India (2) to the world.
Rgds,
Ali Koya
Abu-Dhabi
Meetul.Com is also a good website for sending SMS to GSM phones. Though they dont support Reliance but being absolutely free and beoz they dont ask for registrations, they are my favourite.
Mbl no.starting from 919865 is not working in pay sms also what is the reason.
hello
I had booked a domain with them for Rs. 350. I sent them the same amount for renewal. They did not renew it for about two weeks, and then sent me an email-- just two weeks before expiry of the domain, demanding Rs. 450. I cancelled the order, but they did not return the money. They also locked the domain. They did not respond to my emails in this regard.
They are resellers of directi.com, and so, I sought intevention of directi and got the domain transferred to another reseller. Directi declined to intervene regarding refusal to refund the money and suggested that I approach cyber police or Consumer Forum.
i want ring tones to mobiles.i think it is better.my number 9346265032.
hi ,last 1hours i am trying free sms on reliance. there is no site for relisnce anybody know hoe to send free sms on reliance mobile give me the link of it ok thanks
What can I do to connect and send and receive email?
Use sms.ac to sms to maximum GSM phones in any place of the world.
But it gives only one msg. free per day.
It works exactly.
It is the best connection for India. But rates should be lowered with more time to talk with one whom you love more. I mean more love more talk time.
how to download ringtones in reliance mobile other than the r world ones
some ppl r doing it seems
For those who don't have an account yet: I got my gmail invitation here: http://gmail-smtp-pop3.uni-honk.de/english/
Maybe you get one there. Good luck!
Michael
Can any of u tell me from which site i can send free sms to BSNL mobile in chennai.I tried smsto india...its not working.
Has anyone tried sending SMS from Sprint PCS phone
in USA to India ?
Is anyone with Sprint PCS service able to receive SMS from India ?
i received a document from patna in 3 days , where as first flight told us that it will rech it's destination i.e delhi within 24 hrs.
javed shams
delhi
very poor service by first flight
hi....
i just wanna know how can we send free sms through web to reliance india mobiles..../?guys im sick and tired of asking this question again and again....i don't even know how many times i must have asked this....but plz guys ...only u can help me out by suggesting something....Is there any site which is FREE for sending sms through computer to reliance india mobiles...i have a postpaid RIM....
plz let me know on my id...prernabakshi@hotmail.com....i'll be waiting for ur reply....
regards....
Yes, Quality and connection time is very good. However, there are minor flaws in the network design.
1) when I accidentally enter a wrong pin or wrong number, it doesnt ask me to enter again. All it does is, disconnects by saying, thank you, goodbye.
2) If I associate a pin with a phone, and if my balance is finished, I cannot use another card(friends card) using my phone. This sucks big time.
Else everything is good.
Satish M
Priya,
You can send an email to any mobile user in india (except BSNL user) from your Sprint PCS cell phone.
Email addresses for different service providers are,
hutch/celforce: mobilenum@celforce.com
Idea/AT&T : mobilenum@ideacellular.net
Reliance: 91+std+number@ri.irisme.net
Airtel : mobilenum@airtel.net (not sure of this one)
For someone to send you an email, your email would be yourcellnumber@sprintpcs.com
Hope this helps.
you enlightened me man. I was always confused as to why that i.e thing was that is. Never bothered to find out though.
hi everone !!
someone plz tell from where we can send free sms to reliance/hutch/mtnl/bpl in india.
thank you in advance.
.. manoj
Hi,
Is there is possible to sent SMS from computer to mobile (computer is not connected to internet)
How Can I sent sms to reliance mobile from Internet.
thanks
Rajaram
Hey guys,
I read all the above and some of u r really desperate to send sms thru internet.
I know only for Airtel - +91mobilenumber@airtelkk.com waaallla msg sent !
Let me know if u can get for Hutch.
Enjoy messaging !
Bharath
bharathmv@hotmail.com
check out the below sites to send free sms to almost all the mobile no.
http://www.funsms.net/freesms2india.htm
http://www.spicesms.com/
http://www.kavathiya.20m.com/index.html
you can also use yahoo messenger to send free sms but seems yahoo does not support all.
enjoy.
Very poor performance...
Its acceptable that the networks were busy so I could not connect. After trying several minutes, I was able to make a call. But on my second call to India, it either will not connect or will keep telling me "Your account is already in use".... Called customer service. Waited for 15 minutes, got a representative, she took my number (which is stupid becuase I already enteredd it when I said I am an existing customer (remember Press 1 if you are an existing cutomer??)). Ok so she takes my number and then doesn't answer for another 5 minutes (hear the irritating music) and then I automatically disconnect!!!!!! This sucks!
I have been a customer for so long making frequent calls but I will no longer use Reliance India Call anymore and will not recommend it to other people like I used to. Very poor performance. A failure!!
IT STILL SAYS CURRENTLY IN USE 50 MINUTES AFTER I HUNG UP MY FIRST CALL!!
I think govt. should stop the service provider like firstflight. They are shukkkkkkkkkkkk.
what is the calling rates for india from vancouver
Well..
http://www.spicesms.com
is good.. I've been using it for the past few months. Its faster, and more efficient compared to Krify. And Reliance free SMS.. Does it work?
thanx for that link http://spicesms.com is good.
But wat abt reliance msging..? Now reliance has a 10 digit no. 93xxxxx format. How do we send sms to this?
Can the author throw some light on this?
Meera,
I think the format now will be 91+93xxx-xxxxx@ri.irisme.net. However, I have not tried it yet. So, I am not sure.
I mostly send my messages using smscountry and in that, both number formats (old area_code+number format and new 93xxx-xxxxx format) work.
HTH,
- Bobby
hi guys !! i tried sending messages to BSNL (J&K) and reliance delhi , from www.funtooz.com, the message shows it went thru . check it out whether it actually works !!!
here lot of guys gave wrong information. but here i am giving 100 percent gunine.
for Andhra Airtel mobile: number@airtelap.com
for chennai airtel mobie: number@chennai.com
for karnataka airtelmoble: number@airtelkk.com
for Mumbai airtelmobile: number@mumbai.com
its 100 percent correct, u can try from ur email just type in too address. suppose u have to send a sms to number at andhrapradesh. just type in TO collum
9849012345@airtelap.com
www.orkut.com
sir, i want to know the service and the feature provided by the public sector and private sector toward mobile service
Spaceforhost.com has since refunded the money paid by me (Rs. 350).
Hi friends,
if you need bulk SMS service than check out www.myhostworld.com , the site offers bulk SMS services to almost all Indian networks including BSNL, MTNL and Reliance
You can sent free SMS to BSNL through http://www.imobile.co.nr/
i want gmail account plz send me gmail account at eagle_ivy@hotmail.com
Regards,
Imrna
RelianceIndia can talk India very good.
I am yet to receive a letter from Delhi which was sent on 12/01/2005 and whenm i give them the tracking number they say we dont have any information on it.
God!!! if someone walks from delhi to bhubaneswar and delivers it to me it will be faster i feel.
suckkkxx.. indian postal services is faster i believe.
hi
can i sms from com. to mobile relaince number- 3956435
gmail
The URL given below should have the "nofollow" tag:
http://www.cnn.com/
More info at: http://www.movabletype.org/news/2005/01/movable_type_nofollow_p.shtml
TO send free sms to reliance mobiles from your PC just logon to www.smstoindia.net
this site offers you free SMS to any mobile in India including BSNL and Reliance mobiles ..
This site is very usefull for NRI who want to be in touch with their people in homeland . just visit and enjoy SMSing
i get error 999 everytime i try to get yahoo mail and i want to know why.
my test showed me at 5440 kpbs. I'm on Time Warner premium RoadRunner.
can i sent sms to reliance through internet with in the country
pls search it and plsinform me 9324318429 thisis my cell no
first flight service is best as they told me my tickets will reach from mangalore to north east in just 48 hrs which was containing international air tickets and it reached on time. i didnt took much efforts to consult with customer service. thanks to first flight couriers and all his team otherwise it was impossible for me to travel.
Hi
I dont understand what u mean by sending thru Mobile email! Is it setting up SMTP/POP mail on GPRS enabled Mobile, and then sending it? Even in that case the Mobile uses the SMTP server of Yahoo or Gmail which are ordinary email servers.
What do you mean exactly. I'll be extremely happy if u could be a bit clear on this "Mobile Email" thing.
Thanks in advance
Amit
hey guys and gals
gr8 news now you can dowmload all the latest old very old english ring tones on your RIM
go to indiatimes.com and in that go to ring tones and enjoy downloading on ur phone.
for more information mail me on reliance_engineer@mail.com
enjoy
bye and regards
sandy
Most of the SMS to Mobiles is listed in this site http://www.a-iss.com . Airtel, Hutch, Riliance, BSNL, Tata, etc
Please help me to send SMS to reliance from Internet.
its nice
sir,
I want to give the facilities for my website for sending free sms in india, can you give cmplete webformate of indian sms provider so that I can send free sms through my website including bsnl and reliance, please send me way for this work.
Google's new Video Search is still pretty raw. It's easy to use, but that is about it. It is quite frustrating to find a segment of video but not be able to view it. I have checked out a few new services and so far, I like BlinkxTV. Check it out and see for yourself. It is just as easy, if not easier to use than Google (especially if you can't remember the name of the show or program) and you can actually view the segments of video you find.
www.blinkx.tv
hi bobby
my name is kp naidu rel no:09342574748(bangalore) now i am shifted mumbai. i came today. but problem is last 15 day i could't make outgoing and incoming calls. Error msg is : to recive this service plz contact reliance costomer care. last 15 days, daily i cantact reliance costmer care but no response. this is prepaid card and sufficend balance.
kindly imediate response to me
regards
kpnaidu
hi..
i m abhishek. does nebody have ne idea how i can get to know bout the city from a reliance 93xxxxxx no.
I agree funonphone.com sucks. The best site to send free sms in India is http://www.aasma.com/ . Its Free and supports reliance also. I can send upto 150 SMS free every month (5/day). But funonphone.com sucks.
I wanna send sms (free) from Iran to a hutch mobile in delhi/india ...will U help me ????
Hi, This is murali krishna. It's very nice URL. But I want to Send SMS through web site to Reliance India Mobile. But I'm unable to send. Please Help me out.
how can i send sms through email
Hi guys,
I think u are all fukkad type of people, u dont have monies and try to be smarty!
In india we call these type of people BHIKADDE & RIKAMCHOT
Just think how can one provide free when it's costing them, will u give ur any thing free?
call me on +91 9823322331
I got error 999 anytime am trying to log in into yahoomail. What is the solution?
Please stop the Error 999 because I want to log in to my yahoo account
I cannot acess my email due to 999 error. please help
dear sir,
i want to know relaince mobile codes in kerala area wise.
iam waiting for ur favourable reply.
Regards,
Kishore Kumar,
"She looked absolutely gorgeous!"
I thought that you said that she looked "too perfect." :)
can anybody give me an idea how can i send free sms to a bsnl mobile withou have gsm or gprs connection, please comment urgently a girl from vadodra
hi sir there are some miss call is coming on my cell so kindly u help me by giving these 93235473996 mobile number and adderess of the person plzzzzzzzzzzzzzzzzz your thankfully
gita
Is there any reliable site to send sms to Airtel kolkata and Hutch Kolkata . I tried so many sites but that were not working . Smsjunction is a nice site I tried it for a hutch phone but for Airtel it does not works . Please Help me
sir
i am getting calls from 9346266197 plz give me the address of this number.
How do you set up a blog on your own domain name?
hiii wut is std code like i know ur suppose 2 use 91 ... then the std code and then the no but wuts the std code suppose 2 be plzzzzzzzzz help !! thank u
Hi Esha,
Since Reliance has converted all old numbers to the 10-digit cellphone format, I would assume that you would have to use 91+phone_number. No need of STD code.
So, if the number is 98313-12345, use: 919831312345@ri.irisme.net if you are sending email from your cell phone or 011-91-98313-12345 if you are calling up the number.
- Bobby
Absolutely ! She looked awesome I should say. But there was some problem with her accent.
hii thank u so much but i tried sending this from my cell ph its a nokia 3587i and its a prepaid ph.. my service provider is alltel. so i tried sending my message but it didnt reach the person i was sending it 2 does this usually happen?? and i was wondering if i cud send it as and email from an email address
Esha,
Well, it works for me. My provider is Cingular.
However, for quite some time, I have been sending less messages using my cellphone and sending more using http://smscountry.com/ .Messages sent through them always reach without any problem. Also, the rate is very cheap - 3.2 cents per message. If I send from my cellphone, it is 10 cents per message.
If your cellphone has an email address, you can set that up as your contact email address in SMSCountry. That way, when a Reliance user in India replies to your message, you will get the message on your cellphone. That way, it is better for them because they spend less (Rs. 3 for SMS to the SMSCountry number is Hyderabad vs. Rs. 5 to send an international SMS)
HTH,
- Bobby
I get the message error999 everytime I try to open my mail on my laptop.
hi thanks im going to try and use sms country i tried to buy credits i was just wondering how it works the shipping address do they like send a card home or sumthing or do they just grant u credits on ur computer thanks for the help really appreciate it
esha
ohh and wid sms country can u reply back from ur cell phone ??
Esha,
SMSCountry credits are added directly to your account. I think they manually activate the credits and since they are based in India, it takes about 10 to 12 hours for them to activate it (I guess they might activate faster if you buy the credits when it is daytime in India)
No, you can't reply back to the sender using your cellphone because the notification email (with the message in it) is coming from SMSCountry and not from the sender.
HTH,
- Bobby
hii im sorry for all these questions but i really need this umm soo it says 149rs soo do they convert that into dollars when they take it out of your account ? how much does it convert into thanks for all your help !!
esha
hii wut do u think of this website i think its sorta better http://www.ipipi.com/index.jsp take a look and tell me wut u think
Esha,
Your credit card will be charged in INR. It will be converted into USD by your credit card company. The last time I recharged (Nov 2004), it was USD 3.68 (INR 164.20).
No idea about ipipi.com
HTH,
- Bobby
plz tell me how to send free sms to bsnl and reliance india mobile
Yes. The accent is different, it's not a problem. You cant expect her to speak in Amercian or British accent, because she in an 'Indian'.
plz send me free to sms from reliance phone URL.
Hii .. I have tried so many sites to send sms to airtel kolkata(calcutta).. meetul.com and smsjunction.com works fine for hutch kolkata . but it's not working for airtel kolkata . Could u please help me ? Thank U .. have a nice time
please tell me a reliable site for sending sms to airtel maharastra and Airtel kolkata .. pls help me !!
sir
i want a site from i can send mszs , tones etc that contain maximum providers include delhi mtnl for free.
http://coldfire.95mb.com/sms.htm
The above is my site. You can send free sms to any phone in india. There is a 3 min delay while sending the sms and receiving it.
ENJOY GUYS !!!
i want to encrise my hotmail space
how i install lotus notes and domino server.
please give some details about lotus notes and domino 6.5
Hello Sir,
Sub: - Mail is not Send through outlook Express.
We have used the Internet of the Vsnl Company for mail check through outlook express. We have purchase the reliance cordless connection that’s instrument model no. LGE CDMA for mainly use for mails checking through outlook express. There can be receives the mail but can’t send. Please tell us your pop no. & smpt no.
Please this problem solved out as soon as possible.
_____________________
Note from Bobby (8:57 AM 2/26/2005): This comment is not directly related to Reliance SMS but anyway, I have allowed the comment to be posted here. If someone has a solution to the problem, please post it here or email Asheesh at pawanjai@vsnl.net
"Chewing gum in Singapore is as bad as bringing a gun into Singapore"
hii the website mentioned above http://coldfire.95mb.com/sms.htm does it allow reply backs 2 i mean i cant c how they wud allow replys
Esha,
Seems that http://coldfire.95mb.com/sms.htm is actually the Krify SMS page: http://www.krify.com/cell/
I am not sure if they allow reply-backs. But they do send a copy of the message to the email address provided. And they do not allow SMS to Reliance cell phones (9312x-xxxxx)
HTH,
- Bobby
Call for poll:
What are your most preferred calling cards? (ofcourse, other than relianceindiacall)
hi sir
thank for the inproved in the yahoo.com . for now we are not geting yahoo mail in some part of libereia.
she did nice interviews, but i had a feeling there were some attitute problems flying around.
i dunno people... she's a little full of herself off late... she's got an accent and a put on smile with that wannanbe 'monroe' attitude.
All i m saying is she's changed and a "dogs collar and leash is not needed on a cat"...
Aaaahh... after trying all the websites. I find www.aasma.com the best for sending sms to almost any mobile in india. Also you get 150 free sms every month. you can send 142 characters sms's. Its a cool one baby
hii in smscountry. com is dere a way u can sms from u cell ph i know u can reciev smses to ur cell ph but u can send em from u cell ph ??
Esha,
No, you can't send SMS from your cellphone using SMSCountry.
HTH,
- Bobby
We are 1 of the leading SMS Value added service providers in UAE .
We terminate millions of SMS for UAE and SAUDI ARAIA Networks.
Currently we are looking for a good prices on bulk volumes to reach this countries.
I first thought that my school has blocked yahoo mail, Now I realized that everyone is having the same problem. Anyone knows a solution? BTyahoo never worked for me.
I want to send messege [via computer] to start the mobileno.922 in india.this mobile no is in surat.plese found the web site name.
I want to send messege to start the mobile no.922 in india.this mobile no is in surat.plese found the web site name.via net.
hi
i want to know wat is the best way to send free sms to reliance mobile phones
if any body knows then please reply at "agarwal_nc@hotmail.com"
I am having reliance prepaid mobile .how can i download various ringtones from the websites free.
Please sujjest me some famous websites also .
Meetul.Com is best for sms in India.
I have been using it for over a year and I have never experienced any problem from their side. And as Mr. Ati Koya said, being free, they are my favourite too.
"hi what network mobile is +91 135 .......? Is 135 a reliance mobile phone? my friend reside at Dehradhun, what cellular network are providing there? Do you have any knowledge what website for free sms for this network please let me know i need it badly"
+91 135 is the STD code of dehradun. I live in dehradun, here BSNL (DOT/Landline) and Reliance phones use the STD code as a prefix before their numbers.
Yes Aasma!, www.aasma.com is the best website and their paid plans are also good. The best part of it is that SMS are sent from your number as sender, that means just like if sent from your mobile.
Bobs,
looks like "the invites appear right below the Google search box", this only works only in IE and not in Mozilla. Interesting!
I want to send sms free im from monaco
Anuj,
For me, it is appearing on Firefox and Netscape but not in IE. Interesting!!!
- Bobs
can i want to send sms to any reliance moblie
with pc
I use www.aasma.com to send Free SMS. Does any one know how to avail the paid plans to send more SMS..
thanks to this forum now i can send free sms to reliance via rworld on rim & web. BY USING RI.IRISME.NET THROUGH THEIR NETWORK I AM ABLE 2 SEND SMS TO ANY MOB NETWORK IN THE WORLD.
U CAN C MY POST IN ESATO FORUM, WAPOC.COM & LEECULT.COM (WAP SITES). TO KNOW THE TRICK WITH COMPLETE DETAIL SEND ME EMAIL WITHOUT ATTACHMENT
how i can send sms to UAE mobile pnone?
HI,
I WANT TO KNOW IS THERE ANY WEBSITE FOR SMS TO RELIANCE INDIA MOBILE(RIM),WITH OUT TAKING ANY CHARGE,AFTER REGESTRATION/MEMBERSHIP i.e. TOTALLY FREE.
How to send sms from the web to Reliance India Mobile in mumbai for free....
Thanks Bobby. It works!
I'm getting the 999-error, what do I need to do? Looks like others have had this also.
hey, i have a question. i've been searching around all day for sheet music that matchs up with the song Mariage d'Amour that is on your blog, but i can't find it. i've found senneville's sheet music, but not the sheet music from George Davidson for the song Mariage d'amour. do you or anybody have any idea on where to get it??
Hai,
Google gmail os offering 2 GB space as of now and its promising unlimited space in future. See gmail.com
Lets see how Yahoo reacts now.!!!
I think still Yahoo Mail is the Best.
Dont think that gmail offers POP access forever freely.
It is now in testing phase and so is giving free POP access. After its launch, it will surely keep POP access in its premium services.
If you download your gmail by POP freely ...then who will look at the gmail targeted ads?
Hai frens,
Many Free SMS sites are using Email 2 SMS Technology which is now often blocked by cellular operators.
www.funsms.net/freesms2india.htm
I think when sending sms to your frens go for free sms site which use sms gateways instead of email 2 sms technology.
For example in Andhra Pradesh, India...Idea Cellular and Hutch have blocked the email 2 sms technology and when you send sms to your frens in these circles through a free sms site using email 2 sms technology....it will never reach them.
so becareful while sending serious msgs through net. Better send from your mobile.
I love Plone and Zope combination which I have powering my website at www.sebpayne.com. Many companies will provide you with Plone hosting (already setup) on a server. http://www.objectis.org/english offer free hosting with a preconfigured Plone server. I'd give it a go.
Seb
Thanks for the detailed article (and for the link to my article :-D). I found some very informative links from this. Did you see http://yagoohoogle.com ? It's cool. Check it out. Luv, Jo.
The relianceindiacall website is no longer working. It's been the case for me for last 3 weeks. I am using the following URL: https://www.relianceindiacall.com/US/index.asp?mode=login
I tried.
http://www.relianceindiacall.com/
Do any of you know why? If the URL is changed please let me know.
can anyone help me to know a website to send free sms to saudi arbia n dubai..plz help me
Friend,
How to send FREE SMS to BSNL OR TATA. Please email me as early as possible.
If possible i also want to send free sms to other countries free please help me....
Thx's
Vishu is not on April 15th, but 14th. It is considered to be the first day of "Medam" (the first month of the year). Also my Amma's (Mother's) birthday. :-)
Regards,
Jo.
how to send message computer(net)to mobile
can i send a free sms to the below mentioned mobile number
0094777295224
Hi
Can anyone tell me how to SMS from PC to a landline phone which has SMS facility (like TATA Indicom Walky)
Thanks
Pradeep
Hi Friends,
Well all the Reliance Mobile Holders are wasting theire time here there is no way to send SMS via any site for free i have tried
To: 91409392443962@ri.irisme.net but still it does not work if you are paying to enroll with a paid sms site still its the same amount on sending through your mobile. I sugest that send sms through you cell phone only the cost is the same via email.
The above is only a sugestion to Reliance mobile holders.
I keep getting calls & texts from one of these numbers, but I do not know anyone in India. Is there any way that I could find out who is sending them to me?
Hi,
I am having some trouble sending sms to reliance india mobile from america. everytime i sent, i get an error "/not sent: too many possible reply addresses"..... any help is appreciated.
Thanks,
Daipayan
Hi Here is the Website to sent Free SMS to Reliance and All GSM networks around the world, pls check it its limited offer, Enjoy
Hi,
Now the problem to send free sms without need any login is solved thru http://cyberhut.uni.cc/
this supports reliance / airtel / bsnl and many more network in india. just go through the site.
Hi,
Is there any possibility to send sms from net to reliance landline phones
Can anybody tell me How to send SMS to reliance prepaid mobile successfully using HUTCH connection.When I send SMS to reliance mobile most of time they are not delivered.
Sorry,I am not GOOD in English
GOPI
check out www.wickedsms.tk
you can send free sms to reliance!!!
it works!!!
Hi,
How do i send free sms from internet to reliance landline?
nithya...
hi friends!!
cld ne 1 tell me how to send sms to BSNL using SMTP.... plz tell me the domain on which bsnl's mail server is running and the email format..
Thanx in advance
ayaz malik i am very busey sir sorry
i use reliance landline WLL phone as modem. outlook express as email prog.
VSNL account.
What is the smtp server name of reliance?
since my outgiong mails are blocked.....
hi this if for priya and all others...sending SMS TO RIM FONES THRU SPRINT CELL FONES.
i tried the number@ri.irisme.net and it works . my FIL has a RIM fone and he replied to it and i got the sms. as ri.irisu.net. so this thing works.
CAN ANYONE TELL ME HOW TO SEND SMS TO 9869( MTNL) fones and send msgs from there to here?
First Flight Courier service is worst .. i have ever faced .. Never expected this in a city like Bombay .. The fellow comes down to my place and not finding me there .. goes off without even a note/slip mentioning that he had come .. the security informs me about him .. and morever nobody picks up the phone at their Sakinaka Office (Corporate)..frustrating ..
you are my freaking hero, ive been looking for George Davidson's full version of Mariage d'Amour and up until now i've only found wussy clips. you have superb taste, and your links are good too :) (as in theyre not crappy scratchy quality type links)
Hello im, mahidhar i want know my friends mobile number in relaince...I try to called him but iam geting message the find the new number and tellig this web site address but im nnot geting can you please help me man
thank you....
0091-877-312-7095
Mahi,
You can go to http://www.relianceinfo.com/webapp/Infocomm/jsp/nochange/YourNewNumber.jsp to find the new number.
HTH,
- Bobby
hello all
my name is "lucki rj" i'am a telecom engg, i wood like to address about sending sms to reliance phone from a website.
reffer this sms format" 91xxxxx@ri.irisme.net"
this sms format only support reliance telecom which is based on GSM teachnology network in "Assam, Bihar, HP, MP, NE, Orissa, Punjab & WB" Only
but notes: Sms can't be send to Reliance India Mobile which is CDMA based network all over india, B'coz RIM has no web enable SMSC config on there network till now.......
plz replay me back with your feedback on my e-mail id
Hey,
You're amazing Bob! Is there anyway to do this from a Win2000 machine?
Regards,
Jo.
Hi,
I am having a strange problem with my tmobile cell phone. I recently changed my cell number. Ever since I changed it, I am not able to receive calls from India. I tried contacting 3-4 people and asked them to call me on my cell and all of them replied back saying that they were not able to reach me. When they tried to call it always said that "the number you are trying to reach is temporarily disconnected or not in service". They can easily contact cingular or other phone service providers. My old number worked fine without any problems. I tried contacting the customer service but still no luck. Have anyone faced the same problem before. I would really appreciate your feedback and suggestions.
Well, I also had poor experience with first flight. The First Flight fellow came to a location which is just 1 km from my address (somewhere in Ahmedabad), then he couldn't find my address so, went back even though he had my mobile number. I called those guys on the same days and explained them how to reach my address, so the next day finally I received my consignment.
This was something bad, but the first flight can't beat Professional couriers in "Poor Service".
I sent a courier to Ahmedabad from Pune. It has been more than one week, but no one knows what's the status of the consignment. Since last two days I have been calling these guys but no useful response.
Now onwards, I will never ever use for First Flight or Professional Couriers for anything.
iam facing invalid password and id error and also 999 error when trying to log on to yahoo email
dsl
again poor service. i have delisted this from my office
hey buddy, it is nice thing. but do u know anything like this for windows?
I will be thankful to u if u provide so.
Bobby...i think u need to see the website of the person who has commented above (Dhiraj)...i think u will find the last couple of posts straight out of ur blog....including the script that he supposedly wrote!
Hii Sir,
Can I send free sms from pc to a Tata Indicom (walky phone ) which has the facility of sms, if so can u pls tell me the process for which I will be highly thankfull to u. Its a problem of love, that's why I need it as fast as possible, hope u understand me Sir,,
hello all
my name is "lucki rj" i'am a telecom engg, i wood like to address about sending sms to TATA Indicom phone/Walky/mobile from a website.
but notes: Sms can't be send to TATA Indicom phone/Walky/mobile which is CDMA based network all over india.
reffer this link for Coverage information http://www.tataindicom.com/roaming/index.asp, B'coz "TATA" has no web enable SMSC config on there network till now.......
plz replay me back with your feedback on my e-mail id
hi how do you manage to sms from cingular to reliance mobile phone in india mumbai
Now,
anyone can send free sms to orange in india free of cost and without need any registration from the portal http://cyberhut.uni.cc/ this portal also support Airtel (Some region) / Hutch / RPG / BPL / IDEA / ESCOTEL / AIRCELL / CELFORCE these all free of cost.
i like reliance india mobile prepaid.i`m using raloanceindicall calling card its good
Hi I tested this site with RIM (Mobile & landline both) & GSM : Smart Airtel & idea ALL SMS ARE SENT sucsessfully but u have a valid indian mobile number to get ur Password BUT IT IS FREE
www.digi-help.com
So Try www.digi-help.com
Thanks & send me message if this site help u
try for reaching airtel kolkata thru web by clicking...
net2cell.airtelkol.com/net2cell/jsp/default.jsp
it'll sure work...200% gurantee....
if does...plzz acknowledge....
hello all
I'am back with a good news, i have found a web site where in u can send free sms to any operater worldwide including "Reliance IndiaMobile" & "TataIndicom" just login to http://www.nonstopsms.com/ registor over there & u may get free 2 credit, which u be able to send sms to any operator in the world. chk it out for more credit http://61.247.255.186/communicator/pricing.htm
this is a chennai based company which offer bulk sms soluation too, so friends send free sms from this website, when credit are finesh then registor again with deff user name & get some more sms credit free.
plz replay me back with your feedback on my e-mail id lucki.rj@gmail.com
Feature 4umail.net Gmail Yahoo Dubmail.net
Size of inbox 4GB 2158MB 1GB 250MB
Send Limit Per Day Messages 500 100 30 15
Send Limit Per Day 500MB 150MB 30MB 75MB
Max Message Size 150MB 10MB 10MB 5MB
POP3 YES YES NO NO
IMAP YES YES NO NO
WEBMAIL YES YES YES YES
Anti-Spam YES YES YES NO
Anti-Virus YES YES YES YES
Auto-Responder YES NO NO YES
Auto-Forward YES NO YES YES
Inactivity Exp. NO YES YES YES
Hey Folks,
You can Sign up at http://www.rimweb.com where you can get solution to most of ur reliance based queries.
Bye
Regards
Now you can send limited (only 5)sms from your Pc to Reliance RIM phones via Yahoo Messenger, but cannot reply back from your RIM phone. Says "Invalid user". Can anybody help to resolve this??? The reply number shows 8242801 on my RIM mobile when I receive from my yahoo messenger. Messenger needs to receive atleast one reply from the mobile to allow another 5 SMS to the same number.....
Now you can send free sms (upto 5) to any reliance phone from your yahoo messenger. To break the limit of 5 per number you need to receive atleast one reply from the receiver which is not possible from RIM phone as the outgoing number is 8242XXX and it does'nt supports it
Karthik ka mamaji...congrats
hi! u all. finally i think i got a 1 point solution 4 all. u can send sms 2 any mobile no.s including reliance and that 2 for free ( only 2 sms per day). go 2
www.aasma.com and join in. its really gr8. and do tell me your xperience.
bye.
For people outside india, send free sms to india withoud any advertisement in SMS from www.atrochatro.com
Very interesting, especially pi upto 1 million decimal places.
Hai bobby,
Now I am also the owner of Longest Domain Name in this world. Add this to you list
http://www.iamtheproudownerofthelongestlongestlongestdomainnameinthisworld.com
I also have a bad experience with these guys, very unprofessional in after-sale-service. I own the site www.icsrdc.com, for the last 6 months, this site will be unavailable at random point of time, whenver contacted for reporting the same they said that they are able to get the same I am not because my ISP is different or the update of server records is happening slow for my ISP etc. In reality the site's DNS server will be out of service and it takes some time to update the same, its really foolish to host a site of commericial value with these people... ITs a price I have to pay for the lower cost that they ofered. Many a times the mails attached with this domain also bounces
Sir,
I want the details abt buying a domain and hosting pls send the details as sonn as possible
by faitfully
Arun Sasi
try this site, it offers a list of free sms text sites to all countries, sms to india and sms jokes also. www.smsufree.com
Hi every body,
I want to send SMS through my PC to an IDEA mobile (at Hyderbad). Can some body tell me the free and better method. I want to send 1 SMS per day.
smstoindia is a faltoo web site it does not work......i dont know any website from which i can send sms free in india....can any body refer a good site which is reliable and can work wid hutch too
sammar
PAKISTAN
http://cyberhut.uni.cc/ is again providing free sms to reliance without need any registration.
Rediculous service ,first flight, I sent an important document thro first flight to canada, Address was written correctly on the cover but the person received the document had written the country name as UK and the document is misplaced somewhere and i lost an important opportunity
i live in france and want to know how to send a sms with net to RELIANCE PHONE ?plz (9193......)
dear sir
how can send mail for reliance mobile form yahoo mail
I am very new to this site. I have a problem with the hosting company spaceforhost.com. I have hosted 4 sites with this company.
During the last 3 months I was facing problem with them. Sometimes site is not available or email is not accessible. Now my site is up without header and footer. I called them up and no response.
They claim to have online technical support but no one will be available, if anyone comes they do not respond well.
Today I called their office twice, wasted my money. One fellow just kept phone down. They did not even bother what I wanted to say. Now they just say that they are not responsible for the data. If I need the website, upload all the things again.
Do you people think it is right attitude to say this….
Please do respond with your views… I am in an awkward situation since I do not have the back up.
They did not inform that they are planning to do some changes, if so I would have taken the backup. If it is some virus attack I can understand if they say that.
They could have informed me. Now they say it is my responsibility to keep the back up. Don't the hosting people have a back up? One day if the hosting company say we do not have anything. or site. how a company having good reputation exist..
I am living in India, is there any rule related to hosting in India? If anyone have idea please inform.
Jinson Karedath
How such a simple posting can save a day! :-) Thanks, Bobby.
I thought its a prequel to all other Batman movies. Can't wait to see Mr. Nicholson as Joker again!!!
I have been using relianceindiacall for more than 6 months now. Their rates are competetive and the call quality is ok. Some times it is good and some times bad, you get gaps in the voice and you will miss the communication.
I say I would use at least until I find a better one.
hey iam kashif ihave gsm mobile so iam have sms free
sir ""I WANT SEND FREE SMS TO MOBILE IMMEDIATLY.THE MOBILE NO IS 9228132546.ITIS WORKING IN SUTRATH CITY.PLEZZE FIND THE ""WHICH WEB IS SEND FREESMS TO THIS MOBILE"".
Sir,
Can anyone tell me how to SMS from PC to a landline phone which has SMS facility (like TATA Indicom Walky)
regards,
R.Karan Kirti
Well what about this then :
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk/
This is a total of 70 characters including the org.uk. Longer than anything else. It's also a valid place name.
A good web site for free sms and ringtones http://all4gsm.al.ohost.de
i want to sms by net
how to send free text message from pc to mob from pakistan to uk
Hi Bobby,
I am Guru - heard a lot about you from Pushkar, Damu and Mama (Nitin Tiwari). Reached hear from your Orkut profile. Interesting trivia you got here on domain names.
BTW,
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
is not just a village in Thailand, it is the fully qualified Thai name for Bangkok city. As per Lonely Planet, it means "The city of angels, the great city, the eternal jewel city, the impregnable city of God Indra, the grand capital of the world endowed with nine precious gems, the happy city, abounding in an enormous Royal Palace that resembles the heavenly abode where reigns the reincarnated god, a city given by Indra and built by Vishnukarn (Vishwakarma - builder for the Hindu Gods)."
The name was so trippy that a local rock band made a song outta it. They just kept chanting the name again and again throughout the song!
Cheers,
Guru.
If any one using Reliance India phone and not been able to send e-mails through their VSNL account, contact me on hightechpune@sify.com or 09822879883 (Pune) I have a solution for this problem.
Thanks
There were extremely excellent and the best scenes in the movie "Revenge of the Sith".
Good originality and great imagination, great story in this movie!
Here's Photo gallery for Hayden Christensen(Anakin) of this movie. http://www.imdb.com/name/nm0159789/photogallery-ss-0
I love Star Wars series the most!
can anybody email me with a site i can go on and get unlimited sms to mobiles from the computer without paying or downloading??
Hie Guys and Galz, reliance SUCKS... I'm being sent monthly bills of over Rs 1600 a month since over 8 months... I stopped paying reliance any payment 6 months back... and all my bills are due since then... I don't even make 100 phone calls a month... most of them are only local calls to my parents.. I'm sure if a call costs even Rs. 4 per minute , then my bill should not be more than Rs. 600 a month... But I'm being sent bills of over Rs. 1600 since over 8 months.. The worst part is... they don't send you a list of local calls you made.. Also... if you know... several of my own reliance user friends also realize the same...Reliance is still charging for all unanswered calls... That means.. you just make a call to a number, and even if its not answered, you will be charged of the duration you kept waiting while the phone waas ringing on the other side! Want a confirmation ? Just dial your own reliance number from any STDPCO... and you'll find that reliance network is still cut off from BSNL.. This way, all people on all sides are being falsely charnged while these companies making crores of rupees in a single day FOR NOT PROVIDING YOU A SERVICE...
Isn't this rediculous? Are we all ASLEEP ? If something such had happened in USA then the company would have already received thousands of lawsuits againts them by now...
hi im mohammad i have mobile sony ericsson 300i this is a bad mobile why?
this mobile is hi dont have camera vidou
I am very happy with performance of relianceindiacall. It has superior connectivity clear sound and cheap.
i agree. she's a little too cocky and "unreal" to be sitting there. i think letterman handled her well though.
Cool stuff! Let us know the review after working it out.
Whenver problem tickets are raised, the usual status even after long time(one month or more) will be : > > Query not responded yet..
If they r not responding to tickets, why should they have facility like this.... its really waste of time
Wow! that is cool!
hai . i am karthik,resident of india. i have been trying to create a gmail account since 2 months and i do not know how to do this.if possible please send me a invitation .
hello.i am raja,doing my graduation.ineed to create a new gmail account and require your assistance for this.please offer me a invitation.
ki holl any body frm assam call me09864181798 or love on sms aman
Congratulations!
Thanks Brajeshwar :).
Hello
After Reading Full Thread
It is possible to send SMS to RIM Through email which is sent by mobile.
Let me know that Is moble is GPRS or CDMA
Is +91 is required?
And Also Send me 2 SMS/email to this RIM NO. 9329215503@ri.irisme.net and 919329215503@ri.irisme.net
and An EMail to my email ID " minniawochat@yahoo.com "
SMS/Email must Contain message " SMS from blog.maisnam.com"
Both are Require . I think I can make It
Thanks
I wonder what all they have in store for us. Did you have a chance to test their alpha version?
Congrats!
Dear kirstie,
i don't know, but whatever u said is a "BIG BLUNDER". I m using the reliance phone for last two years. But never got a complaint like that. If fact my all frnds use relaince & we use to give a lot of miss call to other's, but never been charged. Also, there is a misconception about their billing. the mobile only shows the time u start ringing, but actually charged when the receiver picks the phone.
After a lot of experience with other networks, i found it best in all respect. Whether its about call charges, availability, new scheme's etc. u can't get unlimited SMS from same network to network in Just Rs. 50/- per month. even u can make unlimited local calls to any rim number with in a circle & in just 80 paise/min to other networks with a monthly coupoun of Rs. 440/-.
may be possibly ur mobile was dubbed by someone else or may be illegaly used by someone in your absence.
tarun kumar - 09350080485 (All relaince user's are welcome to be "SMSfriend")
Hi!
Is there any facilty to send SMS to tataindicom walky set in AP ..if so what is the format i need to type ..
for eg to airtel customer in AP.
mobileno@airtelap.com
Thanks
Rams..
dear sir / madam
plz tell me regarding the sending message pc to airtel mobile phone.i mean to say that what the aadress of the airtel site which provide the sma service pc to airtel mobile phone.
Hi guys,
I am also having some bad experience with spaceforhost.com , For the first time I host my site with spaceforhost.com (only because their price are so cheap, and I didnt update the nameserver records to them, because I want to test their quality) and for the first 1 week, the server load was normal. After 1 week, they suspend my account, I have send many support tickets, but no response. Then I chat with them via yahoo messenger and they told me that they will unsuspend only if I point the nameservers of my domain with them. Their support team are really fools and having no standard. I asked via chat for atleast 2 weeks and atlast they unsuspended my account. I am a freelancer and I stored many of my projects on their server. One day, I tried to log in to my account, but I couldn't. I have send many support tickets again, NO RESPONSE. Again, I approached them via yahoo chat, they said simply "datas gone". I asked the reason, but no response.I asked them to retreive the datas from their backup, their reply was "no backup". I lose $800 by that incidence. It is better to save our datas to a broken harddisk than save to their servers.
I request you all the people, please dont host or register your website with spaceforhost.com They have the worst support in the world.Beleive me!!!
Suresh,
Spaceforhost did it again! A couple of weeks back, our site went down. I chatted with them and the customer support was really rude. They told me that they would activate the account. I waited for a couple of days and nothing happened. Finally, I decided I had enough and I shifted our website to another server. I had learnt from my previous experiences and used the backup I had taken a couple of days back.
Bottomline: Take backups regularly. I take backups at least once every week or every two weeks.
Yeah, SpaceForHost sucks - big time!
- Bobby
Hi,
Check whether your internal microphone is working, ie., you don't need to attach an external mike to record sound or for voice chat.
We bought the same system and there is no internal microphone in that. and decide whether you are still happy with that
hai bobby.i am carthik .i too want to create a gmail account which most of my friends have already done .please kindly help me.
i have error 999 sometimes when wanna go in yahoo games,..what shall i do?
Whats up with you buddy?
She was too artificial and made up. She has forgotten herself on the way up and she should try and quit the madeup accent.
how I can send sms to MTNL mobile in delhi. The mtnl site also gives a service to send sms but it is not reliable. as the msg does not reach all the times. if i can tell any website which can send FREE sms to MTNL(delhi).
Thanks
Hi Guyz. I am trying to send a free SMS to this number, 9327489118. It is in Gujarat, Baroda and its a reliance phone. I tried each and every possible thing but I cant do it.
And I am just confused about one thing. That, 93xxxxx@ri.irisme.net ..........WAT IS THAT??? so can I send it from Yahoo Mail? can I just put the mobile number and send it?? Is it going to work?? Please please please HELP ME here someone... I would really really appreaciate you guyz. A friend in need is a friend in DEED guyz. Please help... Thank You very much....
- - - Rameez...
How can I send an SMS to a 922 mobile number in India from USA? Also is a 922...number a TATA Indicom number? Thank you!
hey guys,
plz tel me vat r the ids for sending sms to orange , airtel , Reliance (in mumbai) through my email accts.
plz the only id i no is of BPL , its ur MObileNo@bplmobile.com (that 2 4 mumbai).
plz let me no , even u can send me mail also.
Regards,
sanket
Checkout www.intentblog.com -- Lots of celebrities wirting in one blog.
Congratulations!!!!!!
Came across your blog after visiting your home page after a loooooooong time. Will call you in the weekend
----Varma
Send sms to orange free of cost from http://cyberhut.uni.cc/ without need any login.
heyyyyy TANKS
i copy pasted yr post
http://imnutsincapsmisc.blogspot.com/2005/08/aamir-khans-blogg.html
can u please tell me ki agar reliance to reliance free connection nahi hai to reliance to reliance call karne per per minute kitne charges hai
Hi bobby,
Hope u r doing good. I once dropped a comment in ur homepage long time back... I have a Toshiba portege R150, looks much better than a viao but i have a very bad post purchase dissonance. I overpaid for the features i guess.. It's centrino is only 1 Ghz with 256 MB ram and no blue tooth or even a firewire so i couldn't connect a handycam to it.
i keep gettin this error 999 message when trying to access yahoo pool, help please!?!?!?
I love Google.
hello all
my name is "lucki rj" i'am a telecom engg, i wood like to address about sending sms to reliance phone from a yahoo messenger.
but notes: Sms can be send to Reliance India Mobile which is CDMA based network all over india, after the sms which u receive from yahoo! messenger ensure u replay it back ofter 3 message, if not u can not send sms are receive sms from the messenger to the perticular number, Download the new version of yahoo! messenger from http://download.yahoo.com/ so that u can send and receive sms any point of time,
if this information is useful plz replay me back with your feedback on my e-mail id lucki.rj@gmail.com
Neha ji,
Reliance to Reliance charges aapke tariff per depend karta hai. Na hi aapne ye bataya ki aapka mobile hai ya fixed line ya WLL aur na hi aapne apna tariff bataya aur na hi aapne ye bataya ki aap jis Reliance phone per baat karna chahti ho vo mobile hai ya fixed line ya WLL aur na hi ye bataya ki aap STD karna chahti ho ya local.
So how can i help u.
Lekin phir bhi mai aapko reliance ki site bata raha hoon jisse aap tariff check kar sakti hain.
http://relianceinfo.com/
USE REDIFF BOL MESSENGER SERVICE FOR SENDING MESSAGES TO RELIANCE INDIA MOBILE AND RELIANCE INDIA PHONES ... TRY NOW !!!
YOUR RESPONSE IS WELCOMED..
PLEASE UPDATE ME ON nasmal@gmail.com
heloo sir h r u my hotmail account is 2 MB n want to increase my account 250 MB tell me wat is the procedure to increase it
First flight courier making people fool. I sent document
through first flight on 10-oct-2005 from Margao (Goa) to
Patna (Bihar). they told that courier will deliver on
12-Oct-2005.It was very improtant document for me.But
they delivered it on 16th October.
I called all offices/call center of first flight but
they are very irresponsible.No body was telling why
courier is yet not delivered while it is shipped from
mumabi on 11th-oct-05.
Later, on 13th oct on online tracking i get status
"Shipped from Kolkata". Then i called to patna office
and they told person who come with courier miss the
Train.And then i come to know how first flight are
making people fool.
They are sending shipment by train from mumabai to
kolkata and then patna by train.And Charged for air.
How they told me that they will deliver it on 12th oct.?
First flight is charging Rs.70 for this. Other couriers
charge only Rs.30 and deliver within 4-5 days.
so my suggestion "DON'T USE FIRST FLIGHT SPECIALLY FOR
BIHAR AND NORTH EAST"
hi all i have read all the comments posted here.bobby u have done a gr8 job.all those who wanna send sms to reliance try this site.it works www.sms.urspider.com
Hi, Which would think is the best Dell inspiron 700 or Apple 12.1" G4 superdrive.
Thanks
Leland Sullivan
Smsjunction.com is a good sms site but.. i was able to send to 93..... once or twice...? will any one will try out in other states ,,except kerala?
hi all,
as i under stand that u people wanted to send free sms to all over INDIA & US, just login to http://indiatimes.chikka.com/ and register it ,
its free and u get 30sms free every day , u can send sms from online but u can use ur mobile number as a user id so that it will display the same on cellphone......
if this information is useful plz replay me back with your feedback on my e-mail id lucki.rj@gmail.com
??????????????
Looks like a UPS Tracking Number!
Brajeshwar,
That was quick and smart :). You are almost correct. It is a USPS package. Nothing special about the package - just a book I ordered from half.com. Felt like putting in the number and see if anybody else figured it out :)
http://www.google.com/search?q=01038555749524191151
- Bobby
hello, i m nirrmala resident of india. i have to creat a gmial account. if possible please send me a invitation.
regards
nirrmala
No, justified. It is a disguisting habit, especially those who chew with their mouth open.
9428022688084471
wat web site i will go to,to talk to my friends in the philippines?
I thought its your phone #.
:-D
Hmm, Greg, what's 9428022688084471?
Google is of no help in this case.
- Bobs
hai, iam dinesh vydya , i want to send text sms to andhrapradesh mobile numbers, like, 9346xxxxxx, so how can i send through my mail address, can i need to put 91 before the number or not , and sugggest me a mail address,and how can i send ?
thainking U
dinesh vydya
It is an interesting thing. Create a new text message on your mobile with dictionary hinting on. Press all the above 16 digits sequentially from left to right... you will get the message :-)
Hey Bobby,
I stumbled across this post while trying to search for an answer for a problem that I am having with MT 3.2.
I'll create a new entry, and then sometimes when I go to save it, I will get a 500 Server Error while rebuilding the page or site. Sometimes it's fine, and others it isn't. If I delete a couple recent posts, I can get it to start working again. Obviously a terrible way to continue doing things.
Problem is that my ISP doesn't give their customers any error logging. :(
I also noticed the file permissions being 666, as you had mentioned. I changed them all to either 755 or 644 respectively, and was able to rebuild the site, but then the same problem occurred.
Would you be able to provide more info as to what the problem was and how you resolved it (and if you think we have the same problem).
Cheers,
Greg
Great blog, thank-you.
I can't wait to get vista, I see there are some trail versions or something floating around but I will wait until it is officially released.
For now I have found a few vista wallpapers at http://www.vistawallpaperarchive.com and have made my desktop look real nice.
I found a set of icons also, which should be good to use.
Keep up the great blog Bobby!
Reliance was good upto a point. They charged me a single call of 30000 secs once. I disputed it and after 15 phone calls and 10 emails, nothing has happened.
I call them and the usual answers I get are these:
1) Our systems are being upgraded. I can't see your details.
2) My supervisor is busy.
Reliance is a ripoff.
Hi, is any way to send sms to abroad through web> Plz let me know?
want an invite i have 17
Sir,
How can I get a list of incoming and outgoing calls of my tata indicom cell phone.
I accidently deleted a call from my recent call list.It is the call around 02:00 am, 4 or 5 days back.my phone number is 9247110049.
can u give that phone number or list of incoming and outgoing calls during this week.
Can I send SMS to dubai for free?
try spicesms.com
Hello from Kerrville, Texas. I am a musician (organist) and artist (stained glass) and am over awed by the Leonard Bridge Project. It has inspired me to write a drama with music about cultural bridges. I was just about to give up being inspired by anything until I read the article in the Wall Street Journal. Tim Wilborn
hey, do you have any George Davidson full mp3 song ? Why just "L For Love" and "Mariage d'Amour" ? More please !
Can we send free SMS through PC on airtell & reliance mobille
If yes, can anyone please pass me the link.
ARchana
Hi all...i am Nasir...u can send limited sms to the RELIANCE mob..download rediff messenger...in that u can send msg to all inidan mob...u can send 3 sms without recving the reply(per day i guess)if u get thier reply again u are able to send three more..acording to me this is the only reliable service..to reliance phone..soo enjoy it..
haa if u want to send more sms...create many ids!!!
if u found this gud..plzz reply to my id..chatbtv@yahoo.com or nashbtv@yahoo.com
and i dint try sending to other mobiles...
Cool! that is a nice information. I was looking for something similar sometime back.
how to send a free msg online?
Hey, thanks for listing me up.
i have a reliance delhi mobile n0 9312212900
is there any one in the world to tell me how to send sms using my pc
Pl exp me how to send free sms to Reliance India Mobile of MP State from internet
Thanks
hi i lost my cell in april at that time i got some calls from number 09830438108. but now this number does not exist. How i can get address of the owner at that time
hi i want to increase my yahoo stotage bytes capacity already 1 GB is dilled i want to increase my free one more GB.
Hi!
I want to know that how can we send sms or mms through pc to any mobile or a land line phones of reliance, Tata indicom & Walky. Plz tell me.
Asrf
IF ANYONE KNOWS HOW TO SEND SMS TO RELIANCE MOBILE FROM MALAYSIA.PLEASE SEND MAIL
Reliance India is definitely the most reliable and convenient way to call India. I wish it was a little bit cheaper for calls to cell phones (it is 12.9 cents per minute). But more importantly, they need to signal the caller that their money is running out. At the moment, the line just gets cut and that is that...no warning whatsoever. It's so strange because in every other way, Reliance India is so hip, modern and together...the website is well designed too...but no warning signal!!!!!! I really like the way you can view your call record, which displays each call's cost and length (which i wish was shown in minutes instead of seconds). Overall it is an excellent service and I am glad I found it since I call India approx. 3x per day!
Can we send free SMS through PC on airtell & reliance mobille
If yes, can anyone please pass me the link.
daman
Reliance India Calling card is good, but the service sucks when you land in some problem. Some days back I was wrongly charged.
The its been days now they havent yet refunded the money to my account. 1st call they promised me that it will be done in 48hrs, then after 48hrs i called again they promised me 24hrs, after 24hrs i called again they are now not in a position to give me the turnaround time. When told that I want to talk to the supervisor, I was not connected to the supervisor too. My supervisor is busy, this is the anwser I get when asked for the supervisor.
I doubt if Reliance has appointed any supervisors.
The RELIANCE CUSTOMER SERVICE SUCKS.
Regarding sending sms to India. do you have to add 011 in front of your 91?
Hi, u can send free sms to Reliance india mobile from http://atrochatro.com the limitation is u can send only 1 sms per day.
And as posted by Nasir u can send 3 sms to almost ne mobile from rediffbol messenger...
Njoy...
www.smsfre.com send free sms
well, i see all of above messages. but i want to tell you that, we can not send any sms to mobile by using email . so there is no need to try using this type of fool work.
i have a idea " please use "Reliance Sms Topup card" only rate 55/-
regards:
kalpit
www.kalpit.150m.com
SEND FREE SMS ALL OVER THE WORLD{ 100% WORKING}
It will take less than a minute to sign up and you'll be
sending lots of anonymous, prank, fun and SECRET SMS messages to any phone in the
world in no time!
http://sendfreesms.mcommunity.biz/
PLZ tell me the smpt server name of airtel gprs network.
Did you happend read this article ? Some good deal tips.
http://moneycentral.msn.com/content/Savinganddebt/Finddealsonline/P109865.asp
Hi bobby,
You can also test your internet speed at http://speed.kify.com
i want to rejister could u just help me
Hi ppl... I stay in Dubai..I wud like 2 send sms to my friend back in calcutta.He has a hutch sim card.The probs that none of the sites like krifysms or any site as such doesnt have this system of recieving my sms..Can U help me out n lemme know a solution to my prob..
On http://cyberhut.noads.biz/sms.html shoutbox giving a link to download s/w for sending free sms to reliance. this is 100% working now.
Have a wonderful and propserous New Year buddy!
she looks like that girl who plays Dawn in the TV show Buffy... But that is my best guess.
can anyone plzzzzzzzzzzz tel me how can we send unlimited fre sms in maharashtra to mtnl , tata ,orange , airtel network if u know can u plzz let me know
Hi Bobby,
Whatz this dog doing on your server at page http://blog.maisnam.com/?=PHPE9568F36-D428-11d2-A769-00AA001ACF42
Hi,
I am contacting you on behalf of Union Vector Technologies Sdn Bhn, located in Kuala Lumpur Malaysia, with offices in Singapore and Sydney Australia. I would like to present you our 2006 Offer for our stable and economy-class Bulk SMS coverage
What sets us apart from the rest of the aggregators is our excellent and dedicated support via 3 support centers located in Asia and Europe - online close to 22 hours a day, every day and attending to your every need.
We provide connections to various routes with full-feature support such as Numeric and AlphaNumeric originator, Delivery Receipts, Unicode, Binary, WAP OTA support.
NEW: For bulk SMS to European countries such as Germany, UK, France, Spain, Portugal we have at the moment special routes on offer which might not have full feature support but provide for a very fast delivery and good throughput for your IVR, Premium SMS or WAP Push campaigns.
Test accounts for all routes are available free of charge.
Please email me with any pricing and support requirements. If you would like to find out more information on our company and services offered, please refer to our company website at http://www.uvsms.com .
We look forward to talking to you and finding a solution for good business with your company.
Regards,
Keagan Pottas
unionVector
Technologies SDN BHD
MSN: uvsms_sa@hotmail.com
use DTDC? NEVER USE DTDC! I had asked for a package delivery from Cochin to Chennai. I gave my package to DTDC on Friday and it was delivered on Monday, but apparently the DTDC guys never entered it into the tracking system. And assuming my package was lost, I made numerous calls and visits to DTDC regional office in Cochin, and spent a huge sum on STD calls to their head office in Bangalore. The Bangalore head office told me on Thursday that the package has been lost, please make a complaint to Cochin regional office. All this after the package had been delivered on Monday! DTDC may have the largest network in India, but this speaks volumes about their inefficiency.
i want to send free sms to dubai and hte number is 00971505061254 , mine is relaince phone....but i wnat to send sms with free of cost ...is there any possibility of doing that
i am satisfied with the services provided by reliance india but i want to suggess u not to make reliance to reliance free calling card complete here continue it.most of the peoples like it.
so kindly take care of this.
eddie sandeep shilpi etc
I also have a similar thought as Meggan,
http://www.bbc.co.uk/cult/buffy/stars/trachtenberg.shtml
http://just-dreaming.net/buffycomplete/dawn1.jpg
Hi,
I developed a tool for sending free SMS to Indian Mobiles.
you can download it from www.geocities.com/hellokrishna/opensource.htm
if you have TCL installed in your machine (Linux/Unix does have on default), download
http://www.geocities.com/hellokrishna/opensource/SMSsender.txt
and rename to .tcl
now on windows machine with TCL installed, just double click the file. on Unix/Linux machine just do this at prompt "wish SMSsender.tcl"
you are set to send SMS for free.
If you want an self executable (no need of installation) reach me at hellokrishna@yahoo.com
-RadhaKrishna
The most unreliable service
I sent a box of chocolates to the CEO of a company (one of my clients)
I had to declare it at the courier office, which I did - bad mistake. It just makes your package stand out from the rest.
The person got 3 pieces out of a total of 12 chocolates.
They reopened the contents and after helping themselves to more than a few, resealed. And since I had already opened it once, doesnt make a difference if it gets opened a thousand times later.
The most embarrasing time I had when the CEO made a light hearted comment a few days later. I did have to face a lot of embarassing moments. If it wasn't for the good relations I share with that company I might have just lost a big account.
One word - Never use First Flight
hi..
i am trying to send an SMS to a mobile phone in dubai.. the number starts as (+97150 *******)
is there any website tht can let me send sms free of cost.
thnx
where can i find the hutch phones owner address.
really it is good and thanx alot
I used First Flight for a package delivery from Cochin to Chennai. I gave to the local First Flight Office on Thursday Jan 12, 2006 at around 10:30 in the morning and it was delivered at 10:30 on Monday January 16, 2006. I dont have any complaints against First Flight.
Hii, I saw a new site bulksmsindia.co.in wonder whats it all about
Gr8 man!!!
Thanks for such a wonderful link.
I have almost tried all the couriers in India and burnt my fingers many time. I can with conviction tell you that first flight is the best, both for air and surface cargo. it collects at 7 pm in the evening and reaches before 11 am to the addresse in most of big cities where there is direct air connections.
In what Country most people use Chewing Gum??
Soti here, Hey suppose I want to read from a database then output to form elements so that the user can edit. How do I go about this?
Cheers
Reply from Bobby (1/28/2006): Soti, If you are talking about a MySQL database with a PHP frontend, you can try this link: http://www.awtrey.com/tutorials/dbeweb/ .It's a short but good tutorial.
good collections and hard work. I hope the blog shall be very informative and serve its purpose. Also hope that we can togather make manipur shine in the world
hi
i love rellance india mobile
Dear sir,
We have 3,000 customers.We must sent daily 40 to 50 SMS for each customer about the market servey. We are requiring bulk sms software with out modem which was sent by computer internet to all GSM & CDMA mobiles,and also sent maximum sms per one second or short time. Have you possible to arrenge this type of bulk sms server software? Can we sent the sms to 3000 mobiles (both GSM & CDMA mobiles) by only one single click ? If it is possible reply us, with the complete full details of requirements for above and also with your server software price.............MOHANA RAO
thanks 4 giving such important info.
PLZ. TELL ME HOW CAN I SEND FREE SMS TO TATA WALKY(033-5526-****) FROM PC....
Hello, i have a problem with my yahoo account and when i enter the id and password it open but the reply can't open and it keep on saying yahoo 999 error and i don't understnad so i want you to explain everything to me okay.
bye.
Beatrice
Hi ,this is for those who wish to sms to reliance and other mobile service providers try using the yahoo messenger sms service that works really well except for bsnl mobile phones for that use www.kathiyavad.com if any problem mail me
There is a free SMS sender tool available at my home page http://www.geocities.com/hellokrishna/opensource.htm As this is written in TCL, you can see the code, tailor to your needs. Pl send me your feedback and feature addition requests.
hey all, u can send sms free from www.chikka.com, just u download web mobile in ur PC from www.chikka.com and send sms to anywhere in world. u can also receive msg on this web mobile. reply me if u r enjoying this.
Bobs,
How was your Valentine's Day? Long time since we talked. Will give u a call sometime.
Hey All,
Good News to Send sms to any mobile (Inclusding reliance)use rediff Bol >> Sit back and relax >>
u can send only three sms from a account if the limit goes upto 3 try sending after 24 Hrs from the same account, IT WORKS.
SO ENJOY..............
DONT WASTE YOUR MONEY BY SMSing FROM YOUR CELL
I have not seen the movie, but it does seem remarkably similiar to the bank robbery in England. It would not be the first time criminals have copied a movie.
Hey guys I got a great site to send free sms to any reliance CDMA and also other mobile no......the problem is u can send only one message per day to a no. And maximum of two messages per day to any no
The site is- www.atrochatro.com
It is a very good site
Plzzzzzz temme if you like it and post your feed back at my email id
Thanx a lot guys
and how to remove a new line in all the cells of a entore column?
hello readers just i want to know can any one help to me to make a free sms in u.a.e from website. so please any one help me
if any one know than please send me email on sachinp0@yahoo.com
thank's.
What was that song that was featured on the last episode of friends? I think it was an Irish band.
How I can send free sms to reliance & tataindicom mobiles
Hello friends,good to see this blog buzzed up with so many enquiries.Anyways,I came across www.jajah.com wherein you can call any mobile/landline in the world for free(5 mins. they say,but my sis spoke to me for 15 mins. from Dubai).I also found www.atrochatro.com from where you can sms all the mobiles in India(including reliance,bsnl,tata indicom,...).I personally checked it to my own mobile!!I have started a blog for smartphone users from India and world(htc typhoon) which consists of exclusive content which is a result of my research.Check it out @ http://windows-smartphones.blogspot.com
Thanks Bobby for giving me this oppurtunity!!You influenced me into webdesigning!!I came up with http://aspspider.net/dotnethunk Rate me yaar!!
www.sony.com
Hi,
I am fakhruddin from Dubai , I tried reliance mobile no 9352505247 in Udaipur for sms through 9352505247@ri.irisme.net but it failed.
I am making any mistake here, please advice me.
f_alamshah@yahoo.com
www.intel.com
I seriously doubt the monitor is your problem. If video related at all, those problems would be due to your video card.
Congratulations!
tat was a googly!!!
Bobby dude,
Nice blog man!!! Just thought I'g google your name and see what came up... and guess what came up?? Ah!! the power of google... :)
-Pushkar
Thanks Brajeshwar
- Bobby
Hi all, i was looking 4 the same answers u all are looking 4... "how to send free SMS from computer to india reliance mobile"... I found the answer and it is so simple and most importantly IT REALLY WORKS!! This is what u all need to do... just install yahoo messanger... and send text messages on any mobile (even Reliance) with +9193########... n it really works... u can send 3 messages max without getting any reply back, but if you do get reply back, u can send 3 more... on every reply, u can send 3 txtmsgs..n so on. who wants to keep sending msgs if you are not getting any reply back anyway!!! So friends, try this n cheers to success and stop looking for more answers.... cuz i wasted sooo much of my time too. This is totally FREE for the sender... 9193########@ri.irisme.net also work but u are probably paying for outgoing smss. Remember, if i can do it, so can u!! Good luck...
fakhruddin, make a correction on your address....
it should be 919352505247@ri.irisme.net and this should work, i always send sms just like this to my rel friends in india.. it works!
Hi !
You can try out this network monitoring s/w as well - free trial version for 30 days
http://netflowanalyzer.com - its been good so far.
Bye
Be catution with relianceindiacall.com they may over charg your credit card as they did with me and i am following with them nothing happening alway i got the same reply that we are looking into your problemgive us 24 more hrs
I commonly use this site to sent sms to all over world for free, after registration sent 10 SMS for free daily
http://www.stockpaisa.com
good serivce ..afterall indian company . let us encourage ..by submitting all defects related to thier service . but over all it is good .
keep going Reliance . if you could reduce by 10 cents , still it would very appreciable bcoz it will match with outsdie other card service companies ..with quality ... what do you say Ambani kins.
Well, even GMail was beta released on April 1, so this may still be something cool!
Thanks mate. That really helps. Keep up the good work.
Thanks for the pointer to such useful information. Stumbling across your blog has been really useful. I had no clue about COAI earlier.
-Prakash.
I have just tried First Flight for an Internaitonal shipment to Gandhidham, Gujarat. The documents originate from Muscat. I was promised 3 days, but today it is 8 days and still no trace of my package. Tried calling their office in Muscat. The lady at the counter confirms that their internet tracking is unreliable. She refuses to believe that my envelope has not been delivered!! I have spent more money in calling my contact in India to check whether it has reached, than I paid for the courier itself!! I was told a lie that the India office is closed so they cant check the status of the delivery. In fac, hte office is very much open and has no idea about the parcel.
I am praying that it reaches. Otherwise I will stand to be put to huge inconvenience!
Had I read this blog earlier, I would never have chosen First Flight!
PLEASE PUT THIS BLOG UP PROMINENTLY SO THAT PEOPLE LIKE ME DO NOT HAVE OT SUFFER AT THE HANDS OF SUCH COURIER SERVICES!
my no.is 9324762851 i have done my cell phone postpaid before 10 days and my brother he took my cell phone with him for picnic iin goa now can u give me the list of all number which i lost recived , missed , and dailled and sms number which i recived and send plz help me out.
i want missed and recived number on my cell no 9324762851 can give me the details of tahts number
i wanna send sms to reliance through PC. is there any website provides free service? !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
reply me
urs
ever
Elan
My number is 9360672835
I hav tried to send sms through net. but i'm still trying. Is there any one to stop this searching
urs
elan
A simple post that can save a lot of work. Goood Post Bobby. Thanks.
dear friend
finding these info was just exciting..
i'm happy to death..cause i didn't have these songs unfortunately..
I've been grown up with clayderman's songs,I've been dreaming about being someone like him for 10 days..he's my Icon and it makes me fly to see others like me..hehe..
thanks anyway..
do you know where i can find the notes of these songs so that i can play them myself?
How I will search aparticular phone no. through web
i,ve changed my mobile from idea to reliance, bocz i found it was worth and more beneficial. but when i am delevering sms from Dubai, my Lf.companion iz not receiving, why? i am very sad to hold such company who cannot provide sms from foriegn countries to home town. can you suggest me any way to access the service? Mr. Das
from Dubai# cell#+97150-3728241
THNKZ
i have need of 250MB space plz ii am very thankful to u. if u give me a big space of mail box ii need of it
i very thankful to u.
khooban ayan
My name is Will and I am doing a power point presentation and I was wondering if I could use some pictures from your cite. The picture will only be used once at my school and will not be used otherwise. I will be sure to cite your page in my bibliography. Please let me know if this is okay.
Thank you,
Blake Bibat
Hi everybody want to know some secrets of airtel then visit my site i can tell you how to watch live television on ur mobile sets and computers free sms application download them from my site and enjoy sending sms to any part of world for free it work 100% so what u are waiting for just visit my site narendra.Kumar.Mcommunity.biz if know more secrets about airtel then mail me jajga_ranchi_dps@yahoo.com
She is beautiful
I m using Reliance since more than a year & I compleatly satishfied with the service ...they should reduce their price a lil or they should offer flat calling rate for one months for one perticualr number
I am mariappan from Palani
Congratulations!!
wanted to knw..is there any company offering smses[not free] to tata indicom walky. i have a website and am using cellebrum to send smses to users..but it works only for cdma/gsm cellphones, no landlines are supported.
pls tell me..is it possible to send sms to walky connections thru an sms gateway.
btw except for the landline thing cellebrum rocks...just 45p per sms, and 50 free sms on reg.
In general First Flight is comparatively ok to others. They have got a system in place. Some areas some people make errors. I know some of you have suffered, do we have any system (law) to make claims and punish the offenders? That is a big question. Past is past, what about future? How to make fast claims? Its better we focus our discussion towards solutions now.
do any sms me in 9388855532.(reliance).
Thanx for the information .it is really very useful
Hey guys,
If you are that much serious you might have gone with some dedicated servers or something. What all things you are expected to do with these pea nuts amount (~400 bugs)? Simply making baseless allegations against our company.
Mr jinson karedath, We are supposed to provide only hosing not correcting your program. we have informed you before itself that the problem was with your include. If you don't know programming don't blame us.------------Mr SKJ,We notified you many times regarding the virus affected files uploaded on your space. We were forced to delete that. Still you are blaming us?------Mr Suresh,
Your account was deleted because of non payment of your dues within the specified time limit. It is not our fault.
when i reciev message it came like that !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! and anther font no english can you solving the error
how can i make an id in Gmail.com
plz tell me as soon as possible
could u plz send a Gmail invitation
thank u
I am in great need of Gmail.Send me an invitation for creating a Gmail id at faaiz_sufia@yahoo.com.
the pleasure will be all mine.
I guess it works for Windows, but how about when using an eMac? This would help a bunch!
Thanks buddy!!!!!!!!!! it helps a lot...
'Change is the essence of life and change is inevitable.'
:) Good Luck Bobby. Will call you sometime this week.
A poll for Slashdot's redesign is happening at Seen on Slash: http://seenonslash.com/node/296 . So far most think it's just "pretty good".
i found a better option with www.pingo.com/fathersday.do thats offering a promotion till june 20th for $10 in free call when you sign up. so thats 40% off there 11.5 cent rates.
not bad
from your clever compare phone card calling card site
http://www.clevercalling.com/blog/
Thanks a lot for the information. It is very useful.
Hey Bobby:
I have been looking fror this since a long time....thanks,,
AP
its gr8 yaar thanks
how download Kannada movie ringtones to Rilience Mobile
I have been using the service for more than 2 yrs i beleive. And I am very very satisfied. there has been glitches onece in a while ... but come on folks (the whiners)... what in this world is 100% successful error free? Ask Mr. gates... didn't his launching of win95 (or win98)
failed too!! So we should all be happy with what we are grtting from RelinaceIndaicall...:)
Liked this one on Aamir - clairbuoyant.blogspot.com
please give me all commands whic ever we use in plesk
The biggest problem with Reliance India call is their customer support attitude. They never agree to refund the money for non connected calls. I was having below 1min calls and there was an immediately the same number in next min was called still they dont agree it as their side problem.
I prefer to use global telelinks or necc wireless both give good quality and price wise much lower than reliance.
I suggest please please donot use reliance and they should know how important the customer support.
Reliance customer support sucks.
Well, what happen?
Or should I just congratulate you?
She laughed too much at nothing...that was her only problem. Some of the stuff she was saying was funny:
"What about you, how did u get into doing this?"
She was cute and i personally think she did much better on oprah...
wanted to know about web link which can provide us free sms to Tata indicom
I knew there was a way! Thanks!
Thanks everyone for your comments !!
I thought it was just me having problems, as I am not all that "web site" savvy. And thought I may be asking silly questions, that they decided to ignore me?
MY advice also..... As my site has been down for over twelve months now.............. Leave Spaceforhost.com alone.........
If anyone can offer any help whatsoever, my e mail address is nigelwalford2002@yahoo.co.uk
Thanks in Advance
Nigel
Excellent....
Brajeshwar,
Thanks :)
- Bobs
No, Antioch, TN is more like "Ani-ock"
:)
thank
I remember that like it was yesterday! I cant wait til this season kicks off. I have tickets to the Florida game and im so excited to see the gators go down!!!!. GO VOLS!!!!!
Thanks Jenny :)
For those people who think that their consignments are delayed by some courier, let me introduce you the WORST courier service in INDIA - one and only DTDC. Three times in my life I have used DTDC, and all the times they had shown their service.
The first time was in August 2000. I sent a courier to Panchkula youth hostel near Chandigarh form chennai, the courier did not reach the place at all. In the mean time I lost my purse along with my courier bill and DD challan. So I was not able to sue them and I lost the money paid for the DD also.
To my fate, we can book courier only using DTDC through our company. I booked a courier to Erode from Bangalore on March. That courier reached the receiver only after 14 days. That too even after a lot of complaints, tracking, STD calls and so on. Cleverly the courier people anticipating the consequences had got the sign from the receiver on the sheet dated 10 days back.
Again, I had sent a courier to GOA from Bangalore on 21st June. It has been a week (today is 28th) and the courier had not reached the receiver. I spend all my time calling, complaining to Bangalore HO, ring road office, Margoa office and writing to customer care. They dont even hear it yaar. Each call goes for around 10 minutes and 3-4 persons get the details and cuts the call finally.
SO my only advise to all the risk -averse people is dont use DTDC even by mistake.
I checked the Clevercalling.com thing, and it is very good as far as price and quality are concerned. But I am sure there are other good offers out there I might don't know about.
My parents sent me a parcel containing expensive clothes, dry fruits and sweets through DTDC. When I got it it had big holes on it and the clothes were in a tattered condition and all contents destroyed by rodents.On top of that nobody listened to our complaint seriously
Hi buddy, thanks a lot that you have given such an improtant information. its really important for me...
thanks again
I want to send my handycam from nasik to nagpur...which courier should i choose.....i have the option of blue dart and first flight...first flight claim next day delivery with less charge...blue dart asking 800 rs for it and 4 days..are they reliable...
Hi there,
I had this weired issue. I live in Seattle, USA and have T mobile service. I was able to send SMS to any reliance cell phone with my previous Phone Motorola V3 RAZR, but now i changed my cell phone. I bought this new Nokia 6681 from India. Now I am not able to send text messages to any reliance Cell phone. Though I am able to send SMS to any other cell phones like Idea, Airtell and all.
Is there different seetings i need to do in my cell phone. Please Advice.
Thanks
Sachin
Thanks for posting this. I'm glad you are on page one of the results, all the pages above you were junk, but your's had exactly what I wanted.
Yes, I'm lazy too (and forgetful)!
Richard
I can not recharge for my account.web not showing what the reson web not showing.
Thanks, dude!
You can also get updated cellular number prefixes from
http://en.wikipedia.org/wiki/India_Cellphone_Numbering
I sent an important document to UK from Bangalore by DTDC on the 4th of this month and it is supposed to reach UK in 3 working days. I tried phoning the DTDC office and i m informed that the document is still lying in Bangalore. I am unable to track online and i have made numerous phone calls to the office n everytime somebody picks up n says they wud get back to me soon but i never receive any phone calls from them. they themselves r unable to track the document i suppose. whot sort of courier company is this.
i need to claim for a delay in shipping... this is ridiculous n i advice anybody who has plans to use DTDC as against doing it.
it is the worst courier company in the world n they have got such inefficient customer advisors.
if anybody knows how to claim for delay in shipping pls let me know.
thanks
easy way to save the day!
SPACEFORHOST IS WORST! DO NOT EVER host websites with them. Their support staff is SIMPLY IDIOT! I am planning to take legal action against them.
You people just keep an eye on your newspapers. I am sure the person running the spaceforhost will be making a news in Cyber Crime one day for fruad.
i find the my friend mobil nubmer
Is possible in recharging the mobile top-up through only mobile sms services using credit card..?
Hello,
I am trying to send sms through internet on following Reliance user in Cochin, Kerala 04843103720 but it doesn't work with this number. Probably this number is changed and please can anyone tell me what is new number?! Also through which site I can send free sms to Kerala Reliance subscriber? Maybe someone know any site where I can find list of Reliance users in Kerala which numbers were changed.
You can mail me anytime at my e-mail: la_afsun@bankerinter.net or laila22540@yahoo.com
Thank you very much
With best regards,
Laila
I have been using Reliance for 2 years it has been very good. Unfortunately, the site is down now. I don't have any option to reach their customer service to recharge. The 1-800 number used for making call does not have option to reach their customer support personal.
I think, they should improve the customer support access to avoid my situation. If any one has the 1-800 no. to reach their customer support, please reply to this posting.
How can i send free sms to Qatar mobiles number start from 00974..
email me on mohitarnold@gmail.com
However, I would say that it should be done only when you are ready to allow remote connection; for instance; asking your friend to help solve an issue that s/he knows. Otherwise, it is best left deselected at all time.
Anyway, after recently converting to the Mac, I know I'll never go back to Windows.
http://www.brajeshwar.com/archives/2006/07/mac-convert-am-i/
Do you have the piano notes for L for Love? If you do could you please send it to me at my email adress bphung2004@gmail.com
Hi i tried the same but its not working out.
Reliance India call really sucks as a company. They just setup this website and at the backend they dont have anyone really supporting it. You call them day or night, a gaav vaali picks up the phone and she does'nt know what to do.
I did not logonto the website for a long time and naturally I forgot my pin number, so I clicked on the "Forgot PIN" on the website and tried re-creating the pin which I was supposed to get via e-mail. This never showed up even after 20 tries.
The gaav vaali on the phone does'nt know what to do and Reliance wont take payment over the phone without a "PIN" number and they wont give me a "PIN" over the phone.
To summerize, they disabled my account because I did not make a payment and they wont let me make a payment. I am 100% sure within some time they will be reporting me to the credit beureau for not making a payment when all the time its their stupid support system that really sucks which caused all issues.
PLEASE STOP USING RELIANCE INDIA CALL SYSTEM AND MOVE ONTO SOMETHING GOOD.
if any one need to send sms to any of the network carrier please mail to rahawaj@yahoo.com... i hav a software which can send to any network in india FOR FREE
can v send sms 2 any mobile phones via pc . if yes then pls inform me.
Thanx alot it really helped me.
I have this strange feeling that the numbers which I use to call India using RelianceIndiaCall has been given away to 3rd party. I just have some people, from India, call my number multiple times to use their service and say their service and call rates are better than Reliance!
Although its connectivity and quality is great as compared to others in the market, their website, the only recharge method I know of, is out of service very frequently. That irritates me.
I want to send free sms to a bsnl mobile no.starting from 9433..... in Kolkata..But it will be absolutely free and can send more sms.Give me proper idea.
I think she was absolute nonsense in that show, she should be careful on appearing on international media like this. she has gained some popularaty because of miss universe stuff and bollywood, ask her to to keep her silly smile and stupid mouth shut
free calls + sms
can anybody plz send me the links to send free sms across india to any mobile?????????????plzzzzzzzzzzzzzz...........
Hehe... saw this one in a forwarded email.
BTW, how are you? been a long while. :-)
hai have are your happy debavali
Help me i want to open Googlemail.com Accounat
Help me.I need
First Flight is the worst.....Some visuals were couriered from Chennai to kolhapur on 14th of Oct. 2006 and today (24th of Oct 2006), after following up for almost a week ,they are saying it hasn't reached its destination coz invoice is not there.....there service is miserable....it is the WORST ....
It Sucks !!
Reasons below:
1. Cannot connect with valid registration number and pin; from the second time it is saying "Invalid number"
2. Opened another account but same problem again
3. If the call is not connected they charge for that too
I feel very frustrated.
Samik
Reliance customer support is extremely unsupportive...
I've been their customer for about 2 years now and I admit that they have a fast connection and quality talk experience. But run into some billing problems and they treat their customers like shit.
I took off a number from my pinless dialing list for a friend (who doesn't know my pin) to register that as his reliance number in June 2006. Ever since that time I've been charged for all the calls from that number. I got to know it late when i checked my bills, and I complained right away. Took them 6 bloody calls over a week to finall be able to TAKE MY COMPLAINT (Geeeez).
After a week they reply, yeah you took of the number as you said in june, still we believe you were charged correctly. I called back and yelled, the supervisor said he personally agrees i shouldn't be charged, but all he could do was to forward my complain to the technical department again!!!
BIG BAG OF BULLSHITT is what is Reliance when it comes to customer service and accepting their faults. I'd use some other service from now on.
She cant be perfect
so what if she has too much make up
and whats wrong with laughing
Aishwarya Rai is so beautiful inside and out and you should all stop nit picking
I just noticed the same thing, so I googled googlemail.com and Your page was the most relevant one closest to the top.
Thanks
fireryone
lovely side
wanted to know about web link which can provide us free sms to Tata indicom
hey users
I am back with the solutions of ur problems see if you want free sms to any mobile just apply my simple trick go to rediff.com download rediff bol messenger 8 .just register yourself and open rediff bol and now u are ready to send 2messages to each mobile phone everyday.hey guys if you have airtel live activated on ur mobile just you can send sms.for details contact me on my email id i.e jajga_ranchi_dps@yahoo.com.chikka is also good bye
Hi
Can any body tell me hw to send free sms to Dubai
Mail me roshna.t@rediffmail.com
What? Do you mean your Notebook came without a Wi-Fi? I thought you bought your Dell coupla months backs?
Anyway, my mac rocks!
I switched to a Mac recently -
http://www.flickr.com/photos/brajeshwar/186566614/
Can u tell me how to access net in bsnl gprs enabled mobile.
for ex. how to excess sify.com or yahoo.com or rediff.com etc.
Brajeshwar,
The wireless adapater is for my desktop which is in a different room from the router. My laptop does have an internal wireless card and it is working great :)
Your Mac Powerbook looks awesome :). I am sure you love it. I might switch to an Mac later after a couple of years. For now, windows works great for me :)
- Bobby
Yep.... good info to have... just one google search brought me to this link...and the link u have pasted is definitely useful... thanks!!!
Dear Friends,
We are SOFTWARE Solution Providers, Content Providers and Buyers And Sellers Of BULK SMS. Directly CONNECTED TO SMSCs & MANY GATEWAYS GLOBALLY and can provide BULK SMS at very competative prices Economy and Premium Routes with Delivery Reports,OTA,WAP,7-8 Bit,Binary Support.
(Prices depends upon destinations and volume purchase,if you have requirements for South East Asia ,Australia, Middle East, Saudi Arabia, EUROPE, UK, Africa, America & Canada or Globally please emails us back for Coverage Area/Prices.)
You set up your own SMSC at your premises.
Virtual SMSC software HTI Gateway V1.16
We also Provide,best proven Mini BULK SMS GATEWAY suitable for portals, web sites, companys who has Bulk SMS business, or want to start.
We have Empowered many SMs based Websites and Portals, directly can connect ot Telco Grade SMSCs.
We can customise our product as per your requirement.
Looking forward to hear form you for our mutual benifits.
Rgds,
Anoop chourasia, MSN ID: anoop_ch@hotmail.com, Yahoo: anoop0@yahoo.com
High Tech Infosystems
864, khanuja complex, Napier Town.
Jabalpur-482001 (M.P) INDIA.
Tel: +91-761-4035373, +91-761-4017502(Fax)
What, don't just doing a "Right Click > Clear Search History" on the search field do the job?
I was going to send a parcel by First flight as recommended by someone but when I made a search for it's location I got this page in google...and read the encouraging comments one by one....hence I am opting for something better than First Flight ( may be it's name is Last Flight.
Thanks for the advice by all.
http://smsnjoke.com
A huge collection of SMS, Jokes, Quotes, Oneliners, Shayari, Shayeri, Post your jokes, Post your SMS, SMS to india, Sms to Pakistan, SMS world Wide
Yea.. there is website
http://www.smsnjoke.com
From there you send sms to any phone anywhere in the world.
Thanks .
Regards
Ajay.
i thought she was ALRIGHT
except for the extrmely fake accent occasionally.
you could sense that she was definately nervous which is why she laughed for no reason all the time.SHe should just be her natural indian self instead of turning into a compulsive western wannabe.
hi bobby can u tell me your email id i need to have some information from you .mail here nnikita12@rediffmail.com
This was annoying me so much...THANK YOU!
looking to get a gmail acc,
can anyone recommend and help
when i get my new postpaid connection inspite of prepaid connection my application number is 2314171326.
Suppose you want to make conference calls (2 person in india) You cannot do that from reliance. This sucks big time and also *67 (block your number) does not work with reliance.
I think that all of you guys above have gone bonkers. First Flight is the best courier U have ever come across. Don't blame them for nuts.
good site
http://www.aishwaryaraiworld.org/
How to go about moving the file.. mv does not work
with mv -apv ....
bull shite man were is ur bangalore branch
I have fallen in love with George Davidson's piano music & am searching for sheet music to his versions of Starry Starry Night, Unchained Melody, Norwegian Wood, all the covers. Is there any way to find these????
Mary Christmas
Customer service phone number is always busy.
I tried calling their customer service 3 times today and was on hold for more than 15 minutes!
Though I like their connection, they are very expensive. I went Alltel and got fantastic price.
Reliance India Call is great when all is well.
There have one of the worst websites made, I am amazed at how much progress India has made and then I see a poor website like RelianceIndiaCall. I cannot update profile in any browser. I cannot send a contact us email.
The customer support, well I could not get to them EVER. I have spent 4 hours of my life at various times being on hold only to weigh in on the amount of money I have spent on just waiting.
I am actively looking for another service and just might jump to Skype if I cannot find a good replacement.
Reliance India in one word: SUCKS
Don't bother using it unless you have no choice.
Reliance India People> Email me if you think my comments are unfair, I will pinpoint problems with your website, but I will charge you ;-)
Hey !!
do u know the best of google.??
no ??
v have frnds here.
wow !!
isn't it gr8.
Thanks for the pointer to such useful information. Stumbling across your blog has been really useful. I had no clue about COAI earlier.
Thank you Very much
Utterly non-sense. Her embarrasing smile, silly open mouth laughter, giggling, mocking n jeering of the audience was so shocking that it shattered the artificial beauty n intelligence of aishwariya down to nothing.
My point is, this is the proof that she does false n artificial SHOW OFF of her beauty n intelligence in INDIA.
If you don't trust me, go n watch the clip yourself.
http://video.google.co.uk/videoplay?docid=-8633985965177869741&q=david+letterman+show+aishwarya+rai
wow........ nice links buddis thanks a lot..
i got couple of missed calls today, i wanted to locate them, i've been searching very seriously giving many different querries in google at last i found pointers here, gud work buddies.., keep it up,byee
Agreed, the govt is taking advantage of this postiion and has implemented 'a computer for every student' policy. Analysts advise the govt has tendered a project to purchase 150,000 computers by first quarter 2007. The country already has a small group of technically savvy people - movie scenes have been produced by Macedonian IT personnel for various Hollywood films (the larget being The Aviator). Good on them, they may compete with India one day (obvsiously to a lesser extent). USA and China have been an instrumental driving force, lending expertise.
I have the same problem - EXCEPT that when I follow the directions you gave (which I've known about and tried, yet again) -- I experienced the following:
1. There was NO "EML" file type, so I created it.
2. Then there was no "advanced" option, so I selected "Restore" and followed the direction on MS's page.
3. I try to open a saved .eml file from my desk top and all it does it open my Outlook Express and NOT the email itself.
When I return to the FileType tab - the EML reference is GONE!!
HELP! This is quite annoying.
First flight couriers should be awarded with the top most couriers in delayed/unsatisfactory-poor service category.
They seem to play with public’s important documents and do not realize the importance of delivering on time or at least in providing good/prompt feedback.
Ausm work bro... big cheers..
Check out the web based trace program to search these details:
http://www.sindhunagar.com/TraceMobileLocation.php
thank you so much....i had nightmares not knowing what to do because i have kids and there are some adult topics on pregnancy that i did not want them to read.
thank you for keeping it so simple for those of us who are not tech savvy.
First Flight know nothing about pincodes. I had a courier 1 month back and its still not delivered. If i check it online it says address insufficient. Posts sent to the same address through normal postal services reach me correctly and within a few days but. If i call them nobody lifts it. Great service...
Life saving..
Thanks a ton..
hay...its nice....working..but somenew series r not included...4 Eg:-in kerala there is 9946 series in hutch..i cannot find that in here...
You guys are paying for something which you should not pay. Go to www.fonemine.com and try the service. No charge for making international calls to about 30 countries (india included). You get to hear an ad for 15-20 sec and then you get connected to the party (they need to hear an ad to0). I guess you get the point of why they are offering this. Try it. Looks good. Also, they have lot of other stuff since it does not look like that they are a phone company. Looks more like a mobile company doing things for your phones and getting rid of the need to have computers to do anything
well..as far as i know..on mac, hold down Option with either ctrl or apple key and then press the enter..you should get the same thing..
sir i wann. free sms in hutch mobile
sayri , joks , jobs, news, sport
I am really angry about First Flight services. My Pan card is despatched 13th Mar 2007, but today date is 28th Mar 2007, still i not get my Pan card and not even a call also.
So plz kindly do the needful.
I called some people but they are not responding to my questions...
I've always wanted to know how to do that! How perfect!
First flight is really making fool to people..
My parent sent me a photo frame costing 4500 by First flight courier.When i opened that it was empty n now they are saying that they are not responsible for it...
If you want free sms no your Reliance CDMA thn u can do the following:
1. Open one Hotmail email account.
2. Go to Msn Messenger or Msn Mobile thru website.
3. Register your Reliance no. on your Msn Mobile and activate it.
4. Once activated, people can send free sms to you (all they need to do is right click your name on Msn Messenger and choose the option "Send message to Mobile Device")
** And yeah it is free for Reliance nos. so need not worry
how to send the sms through rediff to the mobile out of andhrapradesh but in india
it's cool and very helpful for everyone
Hi Amir Khan i am Zainab...I wana talk to u..i like ur acting ur dansing....plzzzzzz reply me...
wonderfull this is very good link it helped me in many ways.
Thanks dear
hey ..cool man! this is great blog... it's giving such a useful information
hats off u.....keep blogging such useful things
keep it up.
First flight couriers r the worst couriers i have ever come across.I sent a consignment on 30th april and they said it will be delivered in 48hrs.Today is 4th march and no news of where my consignment is.I would not suggest anybody to use this courier service.
I love you. Seriously. I do.
really thanx yar gr8 info
Hello all
i am frightened with all ur replies since im planning to host a site with spaceforhost.com.Already bought domain name..but ...?
its wonderful.my best wishes for this web.may god help all the members of this family.
Man you should have said something to me. I would have at least smiled for you. I just google-searched UT Vols and there I am. I have so many great pictures from that day as well, and WHAT A GAME! Let's get em back in the Swamp this year! GO VOLS!
cool man...cool, thx a lot
i wasted my 2 Hrs here..i think there is no website which allows unlimited free sms to cdma networks...if anyone knw how to send unlimited free sms frm GPRS or Frm PC to any CDMA network plz email me at spatilinfotech@gmail.com thanx a lot in advance...
hey, its a great info, been looking for this. thanks
Radical dude!!
i am from greece so i use greek speedtests such as www.speedtest.gr and speedtest.forthnet.gr i reccommend you to use speedtest which is located in your own country. otherwise there will be a loss
[Tested]
www.160by2.com
catch : u can only send 5 sms to one mob. num in one day
www.way2sms.com
worked pretty fine at first , later the lag time was huge . still give it a try.
i couldn't track the origin of the number 9859106535 . perhaps coai is not updated .
any help???
Thanks a ton, if you get the latest one, please let me know.
the courier services of blazeflash couriers is very poor my friend posted me some inportant documents through blaze flash couriers from sirsa to panchkula it is over than 5 days there is no courier
i talked 2 all their executives their responce is very dull they dont even answering in the right way very poor services
i suggest never post anything frm blazeflash couriers
can any bdy tell me how to made free sms to bsnl prepaid mobile phone using my internet
Hi Amir,
I am Shubhada, today only i came to know about this blog. And the next moment sending you this message.
I like the way you are. Ur sense of humour, ur talent, ur devotion and totally dedication for ur work.
I want ur 1 snap or video clip, can u send me tht on my mail id? plz.......
shubha21483@gmail.com
Hope u wil...
And waiting for ur upcomings...
bye
Take Care
I also wanted to add lagandvd blog of Aamir
that is the most current and is being actively updated by Aaamir himself
Wow! Congrats on the new awesome ride. When are you giving me a ride?
a very nice resource, but needs to updated on regular basis
Great! Thanks. MS Excel Help does not help.
Also another way to change the desktop icon size in Vista is to place the mouse pointer over a icon, hold down the Ctrl key and use the mouse scroll wheel to make them bigger or smaller. This will produce smaller changes (bigger/smaller) with each click of the scroll wheel.
Very poor service
Hey guys thats not right heres Amirs blog
http://www.lagaandvd.com/blog.php?topicid=22
stop copying aamir,stop remakes
dont make bollywood a copywood!!
Professional Couriers - I dont think anyone can beat them when it comes to third rated service. They are atrocious. I regularly get parcels from Mumbai to my Gurgaon ofice annd the experince has been terrible. Packets have been lost, misplaced, wrongly delivered and delayed but NO one cares or even listens at their Gurgaon office.
Infact you will be lucky if they pick up your phone. Imagine Mumbai-Gurgaon in 7+ days in this age.
PLEASE AVOID PROFESSIONAL COURIER.
awesome bobs !! Congrats buddy..u deserve it..hope u r having fun..
All the Deatails are Useful Thx.
hey nice wrk..was realy usefull
amesegnalehu, anta akuay.
you saved my ...
Dude...I love you!
First flight is one of the worst i have ever seen in my life, 100's of banks and consignment hit my door everyday, but to my surprise three time they couldn't find my address, on third time i sent email, left the phone msg to there staff of my contact number, still they resend the package to origin, they just making gimming to make money. check the link for proof.
http://www.firstflight.net/n_zcontrac_new4.asp?tracking1=ZC6693582
please please avoide this courier if you really care your consigment and goods.
Congrats on the new car! :) It looks nice.
My frind sent a courier thru first flight. Distance between her office an mne is 12kms and its 3 days now and I am still waiting for the courier.. Hopeless service.. Just cant rely on such people while sendn important documents
Hi! I'm searching for any Clayderman's notes for very long time, but I haven't found anything. Does any one here have his notes for piano?
It is very sad about First Flight services. My Pan card is despatched 31th Jul 2007, but today date is 10th Aug 2007, still i not get my Pan card and not even a call also.
So plz kindly do the needful.
Please give contact no./ office no who distribute courier at gurgaon,Haryana
Hai,we need 2007 updates of the same information regards mobile number series of different cellular number series in India.As of now Airtel has released 99526/7 series. and 99430 series.Update soon for new series.
hi
Amir
i have visited ur blog and it's very nice and such useful information get for Bollywood
i think u r first blogger in Bollywood
Thanks
I tried contacting the J.B.Nagar office for pickup for three hours but no answer. the secretary at the corporate office gave me another number only to be told that they did not want to do business with me. I called the corporate office again, the assistant refused to listen to my complaints and said that I should keep on trying and hung up on me! WHAT GREAT CUSTOMER SERVCE. keep it up man!
better explanation would be:
mkdir target_dir
cd source_dir
cp -ap . /path/to/target_dir
mkdir : makes directory
cd : goes to a directory
cp : command for copy
-ap : cp options for copying files/folders with the same attributes/permissions...
. : stands for all files/folders
Dude, i needed this feature also, cause my boss does not know how to read. Life sucks and I wished I was dead. But hey anyway thanks.
Thanks for this post
Looking for my document for the last two days but the Ghaziabad Branch office is not picking up the phone. I have made more than 100 call on 0120-2854469/18 and 9312093986 but the response is zero. I can tell the worst service i found in my life so far in courier service. Plz improve urself and let me know the status of my document ASAP>
many thanks for this. has been trying literally for years to figure how to do that :)
yeah i am lookin for that sheet too... BUT I JUST CANT FIND IT! please help me :) that version of mariage d'amour is sooooo beautiful. i've tryed to play it by ear, but i want to check if im right...
First Flight is really pathetic. It cannot deliver goods even to the nearest of places on time and even just to make things delivered they put some imaginary names.Govt should stop them from doing business.My shipment from Allahabad to Bhubaneswar, which they claimed to be delivered in 2 days.And now after a week they have updated their website and made it delivered to some imaginaery people only to make life miserable for Customers.If there is Customer Rights Protection forum that can lead our cause to stop FirstFlight from doing business, please tell.
I visted the country sometime in 2004 and it was an experience I will never forget. Mother Teresa was born in this country.
I have to admit, it is not a very safe place for tourists.
test comment. checking if the comment feature works on the new install.
I know alot about excel, but didn't know that one! Thanks for the tip!
Two tumbs up!
guys. any cdma network mobile overseas can send messages to reliance cdma mobiles. i realised this when i choose '3' mobiles in australia. no other network in australia can send messages - vodafone, telstra or optus. only 3 can (www.three.com.au) cause it is on CDMA network as well. i am sure all CDMA networks abroad can send CDMA-CDMA messages.
Check out this website for most updated information
http://www.informationmadness.com/cms/index.php?option=com_content&task=view&id=40&Itemid=49
i am justin thomas working in SRL RANBAXY (kottayam)we are getting very bad service in kottaym,several times i have informed abt this to their,manager(kottayam_),ernakulam office,head office mumbai,but no use,we are planning to change the service,this we are not expecting from firstflight(check.h24366034,h243660320
Worst Man... Really Worst.First Flight is really worst ever service U can have. My parents sent a parcel to my home address at chennai. Its almost 6 days and I have not received it. I learned that the parcel has come to my town, Perungudi, in chennai, and the man(First Flight delivery man) was unavailable from the next day. His cell number gives either no response or switched off. He also puts it off when the call is through.(Prakash: number:09962001236). I contacted the Perungudi Office. They saiid, the parcel came there, and left as they didnt find the addressee. The parcel was there only for 2 hours, and left to Guindy(Very Strange). The next day(5th day), I called the perungudi Manager again. He told me he will deliver it to me at my office address instead of home address. I waited at office till 4:00 PM but nothing came. Called the manager again. He says. Sorry, I cannot change the Address without authorisation. You can call the delivery person.(9841978523). Called 5 times to this number. Mobile is switched off.
Waited for 1 hour and tried. An Old Lady picked up. She told \"Phone was left at Home\"(Very Good Deliver Man!!! -Keep it Up!!!).
Called the Customer service cell.(044 42027788). It started with a Voice response System, and then there was silence for 3 minutes. Like making a fool of the customer..
Waiting for my Parcel. since then... with Prayers.
what should i do if some one making blank call on my mobile. kindly guide
Watched the interview on youtube. I was embarrassed for Aishwarya. She was laughing when Dave was not even joking. I think Dave felt a little uncomfortable too. Clear cultural gap here. She should have consulted with Indian Americans and prepared for the interview better.
I am a regular user of post paid cards thru Reliance. The quality of the call is good thats why I prefer using it.
But from last couple of days, I am not able to open their website - www.relianceindiacall.com
I have contacted my ISP and they informed that Reliance people need to update their website so that they should allow the new IP address...Can any one guide me what else I can do....
how do i delete the drop down list in the \'search\' program.? PLEASE QUICK
Well well, today October 7,2007...... no replies nor does the online tracking show anything!!!! If this is the kind of service received / rendered how on earth can we face the world? Our leaders say \\\" Mera Bharat Mahan\\\" and here we provide this kind of service..... disgusting is the word.
Sir / Madam,
Today is October 3rd, 2007 and I am yet to get status reply to this mail!!! Lets see after how many days I get a reply, let alone the delivery of the document / consignment.
Orijeet Ghosh
P.S. I was not given any discounts nor the rates lowered for me. In fact I paid Rs. 1,035/- and this is the kind of service I get in return for paying the full amount.
> From: jnjghosh@hotmail.com
> To: caacsd@firstflight.net
> CC: ffcl@firstflight.net
> Subject: FW: First Flight Courier Status
> Date: Sun, 30 Sep 2007 09:08:34 +0530
>
>
> Sir / Madam,
>
> I would be highly oblidged if you could kindly give me an update / status of
> the consignment -
>
> tracking no:FE0013840
>
> dated 18-Sep-2007
>
> sent from kolkatta
>
> for Oman
Thats great!
Hi Bobby,
Looks like you have been imortalised. I think you will get hits on this blog for the rest of the century. Thanks heaps
nice blog.
i thing all ur monthly archives point to ur homepage.
Hi,
I came across your blog which I thought was cool.
I\'ve just opened my own blog (totally new to the blog scene)
I was wondering if you could give me a few pointers or cool plugins you recommend and also how to do the plugins :)
Also here\'s a question - how do you make your blog searchable via google?
Thanks
Ray
Thnx a ton for the very helpful info.. May God bless You.
I found the origin of one number I ws searching for. 9835636326
Couldnt get the co-ordinates of the other number: 9905375396
calls from these two numbers have been incessantly disturbing me since past 3 months. can anyone help me on this front. I will be eternally grateful.
Seems this is the new series released not yet updated in this list.
Very bad service Professional courier has..Mostly in parcel along with address phone number they write .In my case i gave both land line and mobile number but with out calling they return parcel back. They wont return money also..
halo sir,
i am frm hyderabad.i am a big fan of u.i like u r movies as well as ur selection of movies.i suggest u ...give more preference to ur family...d\'t change life partner regularly...ofcourse its ur life...but u r celebrity...people r taking u as model...
Hi
i like he way u are and a very big fan of yours
mail me plz
Athiya
Check this link
http://mobilecodes.blogspot.com/
h r u....
dont wary...everything wil b f9..may god b ever with U..
thanks a lot.. looking for long for this..
y dont u start a technical problem solving website?
it could expose my secrets but now i removed them.. thanks...
aish ko meri taraf se janmdin ki bahut-bahut badhai. Happy Birthday aish
it is a rediculous courier services as it writes and delivers at wrong place into the wrong hands.First flight is one of the worst i have ever seen in my life, 100\'s of banks and consignment hit my door everyday, but to my surprise three time they couldn\'t find my address, on third time i sent email, left the phone msg to there staff of my contact number, still they resend the package to origin, they just making gimming to make money.
I too had the same problem with space for host. There is nothing such as uptime guarantee or customer support for these guys (not these just one guy is behind this). He never takes his phone or replies to email when server goes down.
One time he even deleted all my websites overnight saying that I haven’t made the payment. I submitted all the proof including bank statement to prove it, but for nothing. I lost all my data at their server. 10 sites .... you cant imagine how harsh he was at that time. All my hosted data, my Database files .. all
They have given office address in banglore and other parts. And one day after days of down time I called the so called banglore office and found that it’s another webmaster whose website was hosted for free at spaceforhost.
Even if you have domains registered with spaceforhost, don’t worry you can move to any other host like squarebothers.com. Just get registered with them and from their control panel you can move the site to their control. Of course you will loose the hosting space. Guys at squarebothers.com where really helpful in moving all my sites to their domain.
With about 10 years of hosting experience, I would say space for host is the worst guys I have ever worked with. To all of you guys trust me never register with them.
Recently discovered that they resells UTI banks payment gateway too.
If you want to register a domain register with trust worthy sources like Yahoo or Google. It will cost you 10$, but peace of mind. Then decide the host. I would say go for godaddy.com. They got some excellent offers. If you are ready to pay 6$ a month you can have unlimited sites hosted under them. But have a check on the supported functions and all before hosting. Like they care security a lot and has disabled some php functions, same for mysql.
So domain name go with Yahoo
Hosting go with GoDaddy
Emails go with Google Apps
Payment Gateway Paypal or at the worst case CCAvenue
But never ever SpaceForHost
Rathish
Aamir bhai, aadaab.... when are you getting married next?
I have an idea for reliance & I think this is good business idea.I want to share my idea with reliance. plz contract with me at rohan_sam4u@yahoo.co.in
Rohan Samanta.
Nothing short of Awful service. Even Awful would be a compliment for First Flight by their response standards.
Biggest Plus Point - The web site does not have a Customer Contact No.. Great thoughts put into Web site architecture. or Perhaps a thoughtful one i.e Going by the standard of service, its good that they have not provided any contact details on the website.
Spoke to this girl Pooja at the Saki Vihar center. She seems to be lost in her own world. Without knowing any details of the person calling, she is first informing that she just now gave all the details to me and then trying to find out who is calling.
Truly there is a need to have a forum to ban such organisations from doing business.
Awful man....
I had posted here sometime back.. it seems not yet moderated
this is to tell u about another space for host issue
Their customer details posted freely on the web
http://spaceforhost.com/cart/tempf/
Check it out... My details are also there .... STRANGE GUYS
Rathish
thank you
lovely job dear its cool
but it should be up dated for 2007 on words
What a hell service first flight courier is providing to its customers ? My family had sent a parcel on 19th,November from Balasore,Orissa . But I have not received it till now(8pm,27th November). When I contacted the customer care(phone no.-0120-2425383,as I am staying at Noida.) they put me on hold and after 30 minutes they told that they can do nothing for me..Even the customer care executive used slangs to me. I have decided that I will never go to this First flight.
What a hell service first flight courier is providing to its customers ? My family had sent a parcel on 19th,November from Balasore,Orissa . But I have not received it till now(8pm,27th November). When I contacted the customer care(phone no.-0120-2425383,as I am staying at Noida.) they put me on hold and after 30 minutes they told that they can do nothing for me..Even the customer care executive used slangs to me. I have decided that I will never go to this First flight.
Thank you,
This issue has been bugging me for some time now.
CTRL+ALT+ENTER may also be required (instead) in some versions of OSX and Excel in order to enter lines within cells.
Hi All,
I am Ravichandran.M. Actually my parents was sent the phone in the parcel through Professional Courier from Karur to Bangalore on 03/Dec/2007. Actually here Yeswanthpur branch those people doesn\'t deliver so I called up them and ask the parcel they said that come and collect like this I collect it and open that in that place, but there is nothing inside, immediately I ask them they said that we don\'t know like this, what I can do for this please help me for this if any one have the power to fight with professional courier.
The worst courier service ever I seen is Professional Courier. So please don\'t use this kind of Professional(thief) couriers any time.
try this . it's even simpler to locate a region.
http://www.informationmadness.com/cms/index.php?option=com_content&task=view&id=40&Itemid=49
AR was not herself as in interviews in abroad lately. First on cannes, wher she ws ther as a jury membera aftr \"devdas\" was ther. In her interview, she laughs and does not explain a thing about hindi cinema rather she is just ther to expose her beauty and many of the sponsors of cannes are more interested in her beauty and popularity rather than her work in hindi cinema. Her interview on 60 minutes ws the best out of all the interviews she gave including american today, oprah, and letterman, and some interviews she gave in cannes. In 60 minutes, it ws in bombay and she handled her questions very well but was confused on why did she take the interviewer to her fav. store and asked him for his opinions on how she looks on the clothes. In her other interviews, she doesn\'t seem as an actress rather just as a celeb. from bollywood which is popular from hollywood. But the best questions came from oprah which are very simple, but cladding oprah w/ the sari seemed out of place, and yet we all got the same miss.world answers from her in all her interviews. Come on, in 60 minutes, the reason she went ther for india in miss world is show tht india can speak english?
First Flight sucks! On two occasions Standard Chartered Bank sent me a credit card and the courier would not deliver it to my house in Palghat, Kerala, saying it is not in their delivery area -- and I live six kilometers from their office. Their excuse: it costs 20 rupees by autorickshaw to come to my house and so they will not deliver. The first time, a First Flight delivery man came when I was out of town and instead of leaving a note orally told my neighbour that he was from a courier and had a credit card to deliver. No note, no name, no contact information. Nothing. I tracked them down through the bank and the courier said it had sent back the letter. When it was sent out again, they said they would deliver and made me wait at home all afternoon. The next day they called to say that I should come over to their office. The caller said he had not called the previous day and so he was not responsible for the inconvenience. He said he would send back the letter if I did not show up and that he would not deliver. Given that all sorts of courierwallas show up at my door, why should First Flight -- which charges an arm and a leg -- refuse to deliver at my place?
hi nice to see ur website.
wow
This is the most horrible kind of service i have ever come across.
Hello Sir
THIS IS SHEETAL AN FROM BANGALORE. I WOULD LIKE TO CONGRATULATE YOU ON BEING THE MAKER OF A MOVIE LIKE TARE ZAMEEN PAR! IT IS A POWERFUL MOVIE AND I WILL BE ONE OF THE FINEST MOVIES EVER MADE.
I am an artist running a design studio with my team in Bangalore and i wish/pray that i get a chance to work with a person like you.
GOD BLESS U
Sheetal
Sheetal
hi bobby.. i found sme of ur blogs useful.. i have a doubt.. thought u may clarify.. i recently downloaded a movie file frm internet which has extn .wmv
i have a dvd player that can play files from flash drives. so i copied da dwnlded file into the flash drive and tried playing it in the dvd player. but it dint wrk. later i found that the player doesn\'t play files with extention .wmv but it can play files with extn .avi
can u tell mw hw to convert a .wmv file to a .avi file
i dowloaded a coverter but its a demo and converts only the first 90 secs. for more it is asking me to buy...
can u help dude?
hi amir,
i have some good stories for u.
its my only passion.i am a thinker.and make stories
if u r interested den i can send u my story.
is it possible to send sms in Kannada(one of the indian languages)to canada from uk.
Hi,
I think it might bea problem \'coz you\'re using lowercase for all characters or prolly it\'s just a bug in a few gmail addresses. I have been using the label \"Important\" for over a year now. For more proof, here\'s a sreenshot at http://shayon.pal.googlepages.com/untitled.JPG
By the way, just happened to stumble onto your blog. Looks pretty classy. Even I happen to maintain a blog at Shayon\'s Labyrinth. I have been searching for a graphic designer who could help me in designing a better layout for my blog. I was hoping if you could lend me a helping hand.
I read all the comments above and I agree most of them like reliance
has good quality,good connection and best price.
but if you can\'t open their website. all these qualities are in vain
What a hell service DTDC courier provides.I sent a shirt to my frnd but he dinn\'t get.and they dont have any reaction.and thay r not doing anything.There a claim option but that is also a way to make fool.
Just great...I previously used spacebar key to go to the new line and it was very frustrating...Thank you very much!
thanx dear for such an info really needed it i rreally don knw hw to thank u
:)
Hi Mr. Aamir Khan I\'ve seen your great creation \"Taare Zameen Par\". I can\'t believe that this type of movie is created in Indian Film Industry(Hate to say Bollywood) if I donot see this movie. Really core of my heart this movie is a milestone of the industry and I want you will make this type of great creation and make Indian movie more prosperous. I hope you can fulfill our desire.
thank you Aamir. take care.
actually i want to know how can isend free sms to reliance user except by email
hi aamir.........this is bobby from bangalore.. am a die hard fan of you...i have watched all your movies till date....
recent one was taare zameen par.. its an fantabulous directorial debut for you...i heartly congratulate for the movie,your success, the way you have brought the concept of dyslexia..
there\'s no doubt in saying that TZP is the movie of 2007..
good job aamir...i wish you continue making such wonderful films and am looking forward for your ghajini...
hi aamir.........this is bobby from bangalore.. am a die hard fan of you...i have watched all your movies till date....
recent one was taare zameen par.. its an fantabulous directorial debut for you...i heartly congratulate for the movie,your success, the way you have brought the concept of dyslexia..
there\'s no doubt in saying that TZP is the movie of 2007..
good job aamir...i wish you continue making such wonderful films and am looking forward for your ghajini...
search 9250729721
Hi,Aamir.Thanks for making taaren zameen par. It was such a wonderful film that after watching it iam not in state in conrolling my emotions.I hope Gajni will also proved to be a nice movie
FF Sucks big time. I am awaiting a delivery, the dispatcher has sent me the consignment number but FF says they have not yet received any such package!!! PHEW! And further say that the dispatcher might have updated before the actual dispatch! How did he get a consignment number then?
What also amazed me is that their site only list contact details of a few cities, not all!
I guess since FF is the official courier for IncomeTax Dept., various banks, it really does not worry about other consignments!
Best in my view is IndiaPost Speed Post.
hiiiiiiiii.......Aamir sir how r u?.....i like ur face bcoz it looks like chocolate...and i like chocolate.very much........my fav movie is taare zameen par.......in its own sense......bcoz i like kids.....they god\'s pure gift 2 us.......plz reply me......did u like my comments.....plz sir.
Hi Aamir
I am a very very ARDENT fan of your\'s (like millions of other).I think this bolg has given me the great opportunity to tell you what my heart is feeling for you since i\'ve watched QSQT.i always like your work & almost all your movies are my favourites.But Special Thanks for giving us Taare Zammen Par. The movie was like a beautifull image of childhood drawn on the canwas of silver screen. The character\'s you portray in your movies are very skillfully crafted may it be bhuvan, aakash, raj, sanju, ram nikhumb, sidharth marathe, munna, raja, amar .... I hope we\'ll see many more such characters in future. Good Luck.i\'ll be in the touch with you.
Your\'s Saurabh
hi. MR. A.K SINCE QSQ TO TZP UR WORK HAS REALLY PLEASED US . KEEP IT UP. HOPE TO RECIEVE WONDERFUL WORK FROM U IN NEAR FUTURE...
I am so glad I ran across this solution. It has been driving me crazy. Now if you could tell me how to solve another problem, I would be most grateful.
On yahoo games using Vista, the text is so small. I changed resoultion and made it better but that messes up the other pages. Is there a way to change the text to larger. I have ran into lots who have this problem. Thank you so much for your help.
hi amir
thank you so much for giving such a nice movie.it is surely the movie of the year.i am a doting mother,i think from this you can guess my state of emotions while watching the movie.
i guess a person of hard nut shell would\'nt have controlled himself?herself. it was very moving.
yah i cried a lot.
it was so helpful
thnk u very much for the instant help that this infrm bcame for me, a very gud job that u did by posting the link here, like many i too didn\'t know that every operators codes state wise could b found at one place.....thnk u again
use smsintegra.com to send SMS to RIM/Tata indicom and any GSM mobiles. it\'s very easy and very fast. you can easily set your senderid also.
Suyaraj M
Thanx buddy
I finally got it which I was looking for
Thanx buddy
I finally got it which I was looking for
Thanks! just what I was looking for!
hi aamir....u rock
HI AMIR, I JUST WANT TO SAY YOU ONE THINK THAT MOVIE IS BEST BUT YOU MUST BE SURE WITH YOUR FAMILY FIRST WHAT ARE YOU GOING TO DO WITH YOUR KIDS? IS IT OK THAT YOU LEAVE THEM FOR A WOMAN ONLY ? YES I AM ALSO A RESERVED PERSON LIKE YOU DONT LIKE TO SHARE MY LIFE WITH ANYONE BUT A PERSON WHOM YOU GET MARRY AFTER A LONG PERIOD OF LOVE AND YOU HAVE LEFT HER?AND WHAT ABOUT YOUR KIDS ? DONT THEY DESERVE YOUR CARE FOR THE LIFE? I AM NOT HAPPY WITH YOU AMIR. BEFORE YOU SAY ANTYTHING YOU MUST DO IT IN YOUR LIFE FIRST .
Hey..! Its excellent.
Nice Resource...
We Love Amir
hiiiiiiiii amir,
I have a request,
can u make a film, on him who trie\\\'s his entire life to become a film director, and eventually he fails to fulfill his dream , and he don\\\'t know exactly what are the properties should he have to become a film director, in that dream he may miss his family, friends, and all those who loves him,
tell the crazy people what exactly going on the sets, and not to spoil there lifes.........
hi sir
i am nurat a die hard fan of you. i saw your latest movie taare jamin par. i really like it. congrulate for your the succes of your movie.
buy
aamir,
how did u do such creation?yes i m talking about taare zamin par?i dont have words to praise....still i m sending this.hope u will understand .and i will be waiting for another creation like this...
I think you forgot to mention that your .htpasswd\'s password should be in MD5 hash code and not the actual password.
Try this MD4 Hash generator
http://www.zappersoftware.com/Help/md5.php
uffffffffffff,its hell with FFL courier.The day before i went to this salt lake city based FFL n as it was mt very first courier to abroad i asked f all inside n outside good n packin all good n all.The person who was in a counter said all good,showed him package n asked whats the amount.He told me the amount but i wasn\'t caryin that much so asked him f i can make it latter,he said do it tomorow btwn 10 to 11,then it will be better for u.I asked him 2 take it now but he didn\'t,then i said to him dhl askin double then what u askin,are u shure u sayin the right amount,he said yep,i was shoked with the diff.i was happy atleast some one understan the need(as in other what u sendin is leser amount then the courier charges they ask for).So today again i went in the mornin at 10.30 as per his sayin,n BOOM,the man sittin their said the amount atleast 1000 rs. more then what the earlier man said,i was aghast by the difference,now even after takin whole of my purse i was again short of cash,back to square one,came back without giving and waited for my husband to come and give me cash,he came and took amount from him,then rush back,got the previous day man in counter,told him u said this much so bought this much now the man who was here previously said atleast mlore then 1000 rs difference,he said done the mistake,i agreed humanly error can be done,asked him first to make a roughly figure,he told me,i was ready to pay,he send me to 3rd floor to ask for some dec.aration form,then the otjher man said not 3rd,u r in a wrong department,woowww,tjen was send again to 2nd floor,their a security guard tellin me u have to write in a paper,your whole biodata,n content in paper this parcel holds,ohk,then said not here,u go down again back to the man in counter and he will tell u,what the hell,ohk,then went down back to the counter,fine,now BOOM,he says they didn\'t told u lets go upstair,wooowwww man,i had enough,said what u all think of me,some marchin parade woman,
came out,no more of FFL eva u nless n u ntil its life n death situation,even sayin u i will prefer death then goin back to FFL
Realy great info....Thanks much
Is it possible to find out the contact details of the number
waiting 4 reply
Salaam mr.Aamir khan,
I am Aliya from Karachi.One of your most ardent and faithful fan.you are the most talented actors in the history and this new movie Taare zameen par is the most amazing movie.I have seen it so far for only 9 times and each times the emotions are the same intense and powerful and each time i cry.i dont have words to praise you ,your movies and TZP.i have never sent any mail to any celebrity nor i ever had the inclination but you are an exception.i never admired any one more than you.my wish for you is to get an oscar one day and that day will come soon....Since QSQT you have been my most favourite star and you will always be . waiting desperately waiting for Ghajini....
take care.
Hiiiiii, Aamir
I am a great admirer of your work.Aamir ,pls tell something about your upcoming Movie \'Gazni\".Onemore thing that what is your stand regarding not attending award ceremony held in India.
I agree with all of you.I am in london and i sent a courier to chennai which supposed to deliver in 3 days time but wasn\'t...when we enquired with tracking ID they told that the courier have no Recipient name on it and that is the reason they didnt deliver....What an irresponsible answer!!!!!.....Does anyone accept a courier with out Recipient Address on it........I have the receipt with recipient address which is given by first flight london office and that is my proof that i sent the courier with recipient address on it....what a rediculous service..very much frustrating.....i advice everyone, please be careful in sending the items through the irresponsible and cheater courier like this.....it is worth to go to consumer court on First Flight couriers.....i will support also.
NEVER EVER USE FIRST FLIGHT COURIER IN FUTURE AS THEY ARE CHEATING AND FOOLING THE PEOPLE!!!
Uma
hi! amir ur TZP is just amazing i\'ve watched it 10 times & planning to watch it some more times
hi dearset aamir.
i m big fan of urs frm behrain
i really loved ur first directorial film TZP. i was before great fan of urs acting,now i m also big fan of urs as a director.
i know this is not enough t say about ur self,but i dont hav words to say anything to u.pleeeeeeeeeez keep going on and giv us the great great creations of urs.
i m despretly waiting ur an other project called GAJINI.
tc,love u alot
urs truly
benazir
Thanks. very useful info
Thanks Bobby!
I was looking around for the solo piano version of \"L for Love\" for a while and you brought it to me! As a matter of fact, I love Clayderman\'s songs, but I don\'t know why he mixes trifling sound of non-Piano instruments with the great sound of Piano ;)
\"TARE ZAMEEN PAR\" Outstading, Excellent, Brilliant etc.
Bollywood has very good actors like Om Puri, Aamir Khan,Paresh Rawal, Anil Kapoor etc. But who is making good use of their talent? These people can rock the world, but indian directors don\'t use their mind and has been failed to give them work equal to their levels. Aamir, I am glad to watch your movie Tare Zameen Par. You have done very good job as a director/actor and I am hoping that your upcoming movies will also be outstanding because that makes you Aamir.
Wish you best of luck.
Regards,
Riya
Exxxxxxxcellent
it is not possible to signup on aamir\'s blog. can help? the following message comes:
Parse error in query select count(id) from aamir_user_info where lower(login_id)=lower(\'MANOJ\')
Connection is
thanks
AMIR FIRSTLY many happy returns of the day,but i wud like add that by u claming u r no.1,is pure foolisness,coz srk has made a place for himself in the industry n that\'s not change,people will always luv n adore him,n he will always be no.1 n that\'s not going.He rules bollywood n he always will.U can\'t take that away from him!
Hi Aamir,
WISH YOU A VERY HAPPY BIRTHDAY
Yours
(One AMONG URS countless fans)
kalyan
Oh my god, I thought her eyes were real!!! She fooled us big time. Why doesn’t she just admit it like shilpa when there are hard core evidences of her alterations floating about the net? Check out this old photo from back in the day… HER EYES ARE BROWN!!!!! NOT BLUE/GREY.LOL.
http://blog.maisnam.com/files/images/2005.02….
If she can do her eyes which is what most will not mess around with as it is vital to anyone’s career, god knows what else she has done! She is also done that skin ligtening shit as she is well dark here!
cher Aamir
J\'apprécie l\'acteur que vous êtes, vous faites de très beaux films, Laagan, Fanaa, Taaren Zameen Par, Quel grand acteur, pas trop de mimiques, les expressions de votre visage dans Fanaa est particulièrement réussi, quel beau film FANAA, j\'ai adoré,
En France, il y a de plus en plus de personnes qui regardent les films Bollywood et je vous fais connaître à des centaines de personnes.
J\'adore, j\'adore Aaamir, mon acteur préféré
Excellent
The above list seems got older now. Try this link for latest numbers
http://www.themediasite.net/forums/showthread.php?t=29104
Cheers!!
Vikas
hi dude know what your camry sucks....sucks a big time...dude pimp your camry....its a good car....i wish i could have it but....any way man put some kick ass spolires on it...fire postures of the sides....scissor doors....kick ass rims....n lower it...hope u take my advise
Great info. But still couldn\'t fing origination code of 94337 in the list? Any ideas? Wonder how often this list is updated. Thanks again.
That is hilarious! I have not seen any of their pranks before.
hi amir i am calling u amir because u very close to my heart & i am an mechanical enggineer and i always have a dream to meet u and i know i will meet u
hi sir i cannot recive mms in on my mobile please tell me how to cheak it
Come on ! Can Americans speak English? Ash spoke better English that most North Americans. She is not raunchy like ther Hollywood actresses. As far as \"accent\" is concerned, we ALL have one, you morons! She has a standard accent - a polished and refined one. You N. Americans keep stressing the \"R\" all the time and mispronounce basic words like \"often\", \"leisure\" and \"kilometer\". Would you make the same remark about Mr. Swartzneger\'s accent? What about Selma Hayak\'s? What about your own? Sorry, you guys aren\'t beautiful as Ms. Rai.
@Brajeshwar: Thanks for the note about the MD5. I generate my MD5 in Linux using the \"htpasswd\" command. But for someone who needs .htaccess but does not have shell access (example: FTP access only), the MD5 version of the password is definitely required. Thanks for the tip!
@Chris: Yeah, their pranks are nice :)
Thanks Bobby - you're my Excel hero!
Hi everyone...I,ve been looking for the notes of MAriage d\'Amour for a long time but I can\'t find it ...Can anyone help me...
Fantastic...useful info..!!!
Fantastic...useful info..!!!
This is really very very useful in cases
e.g. unwanted calls.
If you are looking for phone/mobile number directory then join us, http://www.MissCallMe.com
HI Aamir I am your fan and I want to know will you work with Salman Bhai?????????????
Deep
Amir bhai assalamalaikum...amir bhai i am not saying that i am huge fan of u....mai sirf apki shaksiyat aur apki qaabliyat ka dewana hu..TZP proved ur varsetile genius..sach me u have given new hieghts of indian cinema....bhai i belong to a small town of u.p....i want to become a part of ur film production...plz giv me a little chance..i wont let u down.waise ap mitti ko b chu de to sona ban jaye.....amir bhai i\'l wait ur respons..ALLAH HAFIZ
Sir namaste.I am from Nepal. I am planning to a thesis research of M.A. English from Tribhuvan University on your Film Taare Jamin Par.I liked this movie very much because it touched my sentiment.I assimilate myself with this movie.I am going to apply Literary Trauma Theory on this movie.I hope You will help me.I am seeking positive responses from you.
Lena that only tells you are SRK fan nothing else hahahhah
Thanks a lot for this. Saved a lot of time for me :)
Dear Amit
here a Joke for you
Before the marriage:
He: Yes. At last. It was so hard to wait.
She: Do you want me to leave?
He: NO! Don\'t even think about it.
She: Do you love me?
He: Of course!
She: Have you ever cheated on me?
He: NO! Why you even asking?
She: Will you kiss me?
He: Yes!
She: Will you hit me?
He: No way! I\'m not such kind of person!
She: Can I trust you?
Now after the marriage you can read it from bottom
isn\'t it nice??
Vishal
Hey Aamir..
This is Shivani...Like many others i am big fan of you..I like you for your acting skills . May i know what else you like to do in your free time.
Take Care
hellow amir khan jee aapki films dekhi sari ki sari ok lagi . hal hi me aai film tare jamin pr children ki problem dislexia pr based thi . really it was a very good film , very good imotion film. really great and also great lagan, sarfros, isqu, mela,hm hain rahi pyar k, mangal pande, andaj apnaa apnaa ,earth 1947, rangila, gulm, vikas saini shree ram nagar makrana rajasthan
Thanks, great info :)
Small, but very helpful.
Hi
its a great website. I like it very very very very much
Every Number you want to know is available on the site
http://www.internet4mobile.com/numberlocator.asp
Just enter the first four digit of the ten digit mobile and get the operator and state details.
Enjoy.
asslamualikum aamir khan saab.how r u hope u r doing well ,im a dieng fan of u i like ur acting and ur latest movie tzp is brilliant i dont know how many times i cried on watching tzp well done sir thanx for tzp keep it up
ALLAH HAFIZ
hai amir kaku tomake dekte eche kore..ki kori balo to?
wow, that was great post.. thanx for sharing the same...
Mobile Social networking
hai aamir,
i am a big fan of urs from kerala.the movie which made me a diehard fan of urs was fanaa.exceptional performance.i am eagerly waiting for ur upcoming gajini.hoping that it be a block buster.
all the best.
hey aamir , i always gave u credit for th movies u hav worked in and i thought of u as a matured sensible guy ... but this silly blog statin bout a dog named sharukh is degradin ... i mean wat is it wit u celebreties .. how lame n silly can u guys get ... havin these silly 6 yr old fights namin dogs named after each other ... grow up hunnie ... get real ... there r better places n better ways u can spend ur time ...
hi this is imran and am a big fan of urs
and i wanna tALK 2 U
PLZ CONTACT ME AT funky_imran_haque@yahoo.com
Hi dear friend
i want to buy one of the Richard Clayderman`s albums.. what`s ur idea for it?
i want to help me in this case in the order that i fly between songs of this artist.
My email address is: r_sakhaei@yahoo.com
THANKS
aishwarya rai is a fake WHO has done plastic surgery on her fACE think guys she also has layers and layes of makeup on i mean im a girl aswell and younger then the beauty queen lolz!!! so if i had or you had that much makeup lightening camera tricks contact lenses ect on wouldnt we look as beautiful????
hi amis m a gr8 gr8 fan of ursssssssss
love watching ur films
my all time favourite is quamat se quamat takkkkkkk
u loooked so cute in that
i wish u all tha very best
an wish all ur forthcumin films do well as a director as well as an actor
kp smilinggggggg alwayssssssssss
hi amir , ur my favourite actor . i don\'t see movies because today the movie masala lacks the basic thing i.e the story . i want full paisa wasool if i go to hall , but what usually we get a bunch of songs with avg. or below avg. lyrics etc. i see ur films because i belive that ur movie will give a story to understand and enjoy .ofcourse A.R.Rehman provides the wonderful melody to the film.
i have amac and dont have all the stuff they tell me to use,i want to clear google search menue drop down ,i go thru fire fox, please respond,as you can tell iam new to this
salam sir
i m ur dieheart fan . today read newspaper and knew that u apologise shah rukh\'s matter which shows that Aamir khan is gentle man.
sir this is my humble request to that when u get my msg plz reply me
Hello Amir Khan,
How are you. I like your movies very much. You are the greatest actors not only in bollywood but also in hollywood.
Dear Amir Khan
Salam
It is real pleasure to me if you read me ! I am a great fan of your and also try to do and think for better for mankind by www.rokto.org
I saw your all movies and respect you as perfectionist. it is tough job you do with your versatility. Salute to you because we all are performer in our own audience but few are successful in true sense. hence I wish you all the best and invite you Bangladesh. If you visit and comments on my philanthropic work www.rokto.org my work will be successful in a way, so I invite you in Bangladesh and if you come here please let me know i would love to share some views of life with you because i know you are a philosopher.
Salam
HI AAMIR SIR HOW R U
I LIKE EVERY THIN ABOUT U.
BUT DON\'T LIKE ANY COMMENTS ABOUT SHAHRUKHAN WAY U FIGHT WITH SHAHRUKH U MUSLIM AND HE ALSO MUSLIM SO U WAY U MAKE LIKE THAT\'S NOT GOOD. SO PLZ.
DON\'T SAY NEXT TIME ANY COMENT ABOUT SHAHRUKH OK PLZ ...
DONT MIND.
MEHBOOB
FROM
SAUDI ARABIA
Lol you saved the day, thanks :) Damn excel.
i just wanna say u \"hello!\"
Hi! Mujhe aapki film Taare jameen par bahoot aachi lagi.
U r Really Best actor.I m in 12sci in Dabhoi(Baroda)
i want to register my TATA indicom Number of Delhi to my yahoo messnger I am on SMS SERVICE. How to do that as i put my no starting frm 9210****** it sayz it is not correct.plz Suggest meah some measures
Dear,amir
love and best wishes to .i am a big fan of u. i want to know about your struggule life..How u make over this kind of situation....
with,lots of love & respect.... snehashish
Email-mail2sneho@yahoo.co.in
merci!
u r great with TARE ZAMEEN PAR
Your blog is amazing, keep it up.
Regards / Kishore Pinto
I have also enjoyed the miserable service of first flight. The consignment booked for Agra on 29/05/08 from Pondicherry is still onboard their flight. Not even able to trace the packet or have bothered to answer my repeated reminders for the status of parcel. Really these people do not have a sincere team working inside nor have any organisational capacity
u r superb bro. if u know about mobile directories plzzzzzzzzz tell me via e-mail
thanks.....
hi aamir i am not ur fan but love ur acting dude u r a real perfactionist!!!!!!!!!!! regards zaara
The worst courier company atleast I have come across. The delivery boy in bangalore has forged the signature in the delivery challan and updated the status on their site to as \\\\\\\\\\\\\\\"Delivered\\\\\\\\\\\\\\\". How can one trust this first flight. The company that works without any morale and principle is First Flight. They should exit from this business if they cannot deliver the consignment. I believe the Indian Postal Service is definetly reliable that these guys.
I guess all ICICI* entities use First Flight for delivery of consignments. This should be wake up call to ICICI* and many such companies that use First Flight to re-evaluate First Flight and then decide is it worth to continue their relationship with a company that is so UNRELIABLE!!!!!!!!!!!!!!!
Hi Aamir, you are the best actor in the bollwood cinema. No one can compete with you. I can not wait to see more movies from you. your movies are so touching and i can watch them over and over again and never get bored. you are my favorite actor and God bless you so you can keep making your fans appreciate you more and more with every movie that you do. Also, my mom cant stop watching Taare Zameen Par, she cries every time. Please repond...or even just say Hi, that will make my day.
love you lots, Reena
Hi Aamir, you are the best actor in the bollwood cinema. No one can compete with you. I can not wait to see more movies from you. your movies are so touching and i can watch them over and over again and never get bored. you are my favorite actor and God bless you so you can keep making your fans appreciate you more and more with every movie that you do. Also, my mom cant stop watching Taare Zameen Par, she cries every time. Please repond...or even just say Hi, that will make my day.
love you lots, Reena
I am thankful to you. this information very-very important to cyber crime investigation.
Hi I M ANJALI SHARMA.I WANT TO SEND SMS TO DUBAI AT FREE OF COST.NUMBER IS STARTED WITH THAT CODE(OO97150.......)
PLZZZZZZZZZZZZ TELL ME HW CAN I SEND SMS AT FREE OF COST.IF ANY ONE KNOW PLZ TELL ME PLZZZZZZZZZZZZZZZZZ.
Very good Information but i want to know the circle or location of the city also if some have any informtion pls let us know
I tried using this shortcut in conjunction with windows XP scheduled tasks using \"wake the computer to perform task\" option but the computer doesn\'t wake!! I tried it again using the power options and the scheduled task does start after waking the computer. I tested this inconsistancy a few times with same results. Strange.
\"Excel\"lent Bobby!
you guys are all funny. This is basic functionality - look in Excel help, Keyboard shortcuts. Spend 10 min and it\'ll save you a lot more.
hi amir
my self is rajeev from jodhpur. it was great moment when i saw to great legends of thier field i.e u and sachin during ipl final. amir i m really like 2 thnk u for \'taare zameen par\' movie. but im dissapointed when u wrote in ur blog about sharukh. i only advice u 2keep awy yourself from such issues. ok bye nd take care
First Flight is the worst courier service I saw in my life time. I got an important mail to be delivered from Mumbai to Chennai. After keeping the mail for two days they returned it back to the sender. When I checked it online it says address insufficient. If they can\'t find a address in chennai then they are not fit to run a courier service.
When I called to customer care they said my house was locked so they send my shipment back to the sender. My house and my office are located in the same place . They are open 24 hrs. I don\'t in which house they checked. I missed an very important document becoz of First Flight.
Merci! I am dying for it!
Hi Aamir, you are the best actor in the bollwood cinema. No one can compete with you. I can not wait to see more movies byeeeeeeeeeeeeeeeeeeeeeee
Every Number you want to know is available on the site
http://www.internet4mobile.com/numberlocator.asp
Just enter the first four digit of the ten digit mobile and get the operator and state details.
Enjoy.
realy it is so good and helpful
Thanks dude. This is a great help.
HI AMIR,
U R MY FAV.ACTOR.U R DA BEST ACTOR IN BOLLYWOOD AND BEST DIRECTOR ALSO I WATCHED TAARE ZAMEEN PAR ABOUT 20 TIMES ITS SUPERB MOVIE.YOU R THE ACTOR WHO DO EVERYTHING WITH GREAT DEVOTION YOU WNT EVERY THING PERFECT WHICH WE SEE IN YOUR MOVIES.ALLAH AAP KO DIN RAAT CHOGNI TARAKI DE.PLZ REPLY .TAKE CARE OF YOURS.BYEEEEEEEEEEEE
hi mr amir
im fan of super khans
u are my fav actorof bollywood. i like ur all movies but tare zameen par and lagaan most popular and super hit movies. all film industry accepted u as best director. but i dont like ur bad for srk. u said him that srk like my dog or srk my pet name. i thik u will have joked but that bad. plz be gud friend for srk like sallu. plz avoid amitabh bachchan bcz he wants success by all khan. but why he want like this. he think that he s big super star than all khan. u better know his all movies doing flop continously but all media are faouring him. media telling amit all movies hit but all movies are flop so avoid amitabh bachchan bcz he want success by you
plzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz avoid amitabh bachchan
Dear Mr. Amir
I know what I am going to tell you is 100% true in my point of view, but since I am nobody for you so you will just ignore it, though I am executive NRI but comparing to the person I am talking about I am just an ordinary man.
I noticed for the last few months you give too much importance to great Mr. Amitabh Bachchan?
When you released Tare Zamein par you were dying to show him, who the hell he is when you made a great movie everybody will appreciate and it did appreciated all over the world. Same thing I noticed last week when I was watching AAJ TAK and you were talking to Mr. Bachchan, it was looking like he is the ultimate
I do admit as an actor he is superb, he is a class of his own, but at the same time how can you forget when he ignored all the KHANS to invite on his son\'s wedding, how can he ignore you and Shahrukh even he did not invite Mr. Dilip Kumar, whom he always said he copied. Doesn\'t it shows something why don\'t you people( you Shahrukh Salman Saif) make a group and stand against this kind of communal people. If you can\'t stand against this kind of people at least you can ignore him by not giving importance to him, like what Shahrukh is doing.
Tell me one thing everyone knows you never attend any award function, but still all the award function including Filmfare nominate you and many time you win too, but why IIFA has not nominated your movie Tare Zamein par, do you think it happened without the consent of Brand ambassador Great Mr. Bachchan.
I do not know I may be wrong in your point of view but I noticed many times his attitude has changed after the marriage of his son,
Hai amir its kapoor from land of snow Himachal. boss i m ur small fan plese come to our himchal. We want to see our Hero in Himachal. why u make ur movies in other countries we have most beautifull places in our himachal .plese come to our Himachal. and become himachal\'s brand ambessdor to save its culture. \"WE NEED U AND UR HELP\".
hi amir u r very nice bhut sharukh is better then u b.coz he is great human being u r a selfish man learn from sharukh about humanity
Great tip, I had been looking for it for so long.
The camry's engine is rubbish. 117kw and 9.9L/100km. Kia-Hyundai have a new 127kw engine, same displacement and does 8.4L/100km on the automatic tranmission.
Saved the day, thanks.
Amir Dada,
I impressed on ur acting. Ur movies teache more about any subject. \"Kisise payar karna\" ya \"flart karna\", \"Despremi homa\" ya \"Desdrohi hona\". I\'m a student of painting, I got many ideas, many subjects, many images & many more from u. u r like \"godfather\" to me.
I don\'t belive in god but, I belive u . U R MY GOD.
IF U REPLY. I\'LL BE PLEASED. PLEASE DADA.PLEASE.........EEEEE...
hello there, congrats on your new ride. see i have the same ride a toyota camry le, and a week ago i bought a 6 disc changer jbl with bluetooth, and i dont know is it really fit, did you know what i need to install it? thanks
i also miss the times of kazaa...
Very helpful
Thanks, I\'m going to sign up for this now. I didn\'t like the monthly subscription on eFax either.
thanks a lot for the information. if there is a chance to trace the person and the address of a particular mobile number, it is very easy to trace the culprit who sends abusive messages and does unwanted calls. thanks a lot for it
thanks man.. this problem was killing me for long time. Stupid Micrsoft!
i read you producing film on farmers suicide.being a farmer i can provide various reason for suicide.and solution which may help you to make story plot.
thanks
Hi Aamir,
U r too smart to do movies in bollywood, how is ghajni going, i\'m from TN, our director A R Murugadoss, was a talented one, we know u, wen u selected the movie and d director. Its immense pleasure that our director working with u. Definetly this film will give u lots of craze among girls, u\'ve lots of craze among girls in north, but this film will take u to reach every nook and corner of INDIA. All the best, i wish u the film would be a successful one, and it will be a milestone in u\'r life.
plz show me the city from which the number 9179570075 belongs?
thank you very much i was looking for this since 4months thaks a lot thank you very much
god bless you
Useful site, but i couldn\'t identify the no series starts with 90427, this no belongs to tamilnadu. plz help me. if anybody could help me, plz mail me to dhaarvi@gmail.com
Hi,
I get a drop down menu in a google search but it is not web sites I have been too or would ever go to. Deleting history does not work. I do regular clean up on my PC. Things such as cleaning the regestry, deleting history, cookies those sorts of things. What else can I do to get rid of this? I have had this annoying problem for two days.
Thanks
"Reliance" is Indian trade mark only.
Many shops hade phone cards for call.
http://www.phonecardsco.com/ also reliance phone cards,but not inian.:)
realy great help specialy 4 the people who are irritated from wrong calls , and can\'t find the location of the particular number at their own , thanks
thanks a lot man the link was very helpful. is it some sought of clasified information or what?
hi..........aamir,how r u??
Thanks for this code. I had been wondering how to do that until i read this.
I\'m suppose to draw a still life for art class. I want to try my technique with cars, so may I use the top view for a base?
hi.. am looking for origination of the number 9921076116.. cud u help me pls..
I need to integrate the mobile number locator into my website.While searching the database it should not redirect the page.
I need it completely private label on my website.
Can anybody provide me the help
Regards
moneek
Hi Guys!!
Do we have any website as to search the Mobile or Land Line phone number of an individual by his complete name, with or without his complete address, if so pl. let me know about it on the above mentioned email ID.
regards
Chandru
Hi......Aamir........I am a big fan of you. I am from Bangladesh. Pls. keep giving ud the film like Dil chahta hai and Tare Zamin Par.
Allah Bless you.
Mamun
Take
hiiiiii aamir.. i m a big fan of u .... ur new hair style is superb..
Can anyone please tell me where does the series 9769 belong to? I got a call from this number but on dialling back it tells that number is not in use.
I\'ve been using Faxitnice for several months now, and more often than not I have problems. The web interface can be painfully slow, and the Faxtastic application doesn\'t refresh properly (usually I have to close/reopen to get a refresh). I\'ve opened 3 or 4 service tickets and it\'s usually several days before I get a response. There isn\'t enough in the way of documentation, either.
While I have successfully sent faxes, I have yet to successfully receive one (service ticket response was \"this feature works\" with no further explanation).
Hope others have better luck than I have. If you haven\'t already signed up for this service, I\'d advise finding a different one!
HI AMIR,
I\'M ONE OF THE BIGGEST FAN OF YOURS BUT AM QUITE ZAPPED TO WATCH THE ADVT OF TATA SKY. I THINK NONE OF YOUR TRUE FANS WOULD HAVE LIKED IT B\'COZ OF IT\'S BAD THEME & BAD EVERY THING INCLUDING YOUR PERFORMANCE. I\'VE WATCHED ALMOST ALL OF YOUR MOVIES & EVEN MOVIE LIKE TUM MERE HO. PLS TRY TO AVOID THESE CHEAP ADS FOR MONEY.
LOVE YOU
NITIN
Thanks! Very useful.
Jacob
Hi Amir,
You select a good movies. Its very important to work in good movies. Keep it up and BEST OF LUCK.
Cheers,
SK
hai.......amir ji how r u . you know i like your TARE JAMMIN PAR FLIM
YOUR WORLD BIGGEST FAN
KANISHKA PARMAR
hai.......amir ji how r u . you know i like your TARE JAMMIN PAR FLIM
YOUR WORLD BIGGEST FAN
KANISHKA PARMAR
Absolutely!!!
First Flight Service IS WORST OF ALL.
Out of the 2 documents none of the documents have reached till now.
These FU**ERS Should be punished:
http://www.firstflight.net/management.asp
Thanks!
Here is a big article with a full walkthrough of FaxIt Nice\'s services, and it also has a ton (45 right now) reviews from their users, you should check it out if you are planning on trying them:
http://www.faxtoemailguide.com/component/content/article/14-fax-to-email-services/46-faxit-nice-review-and-feature-overview
Hiii.
Aamir vhai..
Assalamualaikum..
I would like to request you to make more movies bse you are getting late as your age is increasing day by day. you can produce movies in diffrent ages i know with the help of your creativity. but we want to see you as a hero in the film. i dont know wheather you will consider my comment or not but as your fan i have right to commend.
ok take care of urself..
have a long life.
The number seems to be originated from Pune or Mumbai.
geez.... thanks a lot man!
Dear Sir/Madam,
Hi this is Asma Shaikh.We Routesms Ltd provide bulk sms & sms gateways to our clients who are into Marketing , Advertisting and Event organizing who are looking sms as tool for informing customers about their products, events and social gathering.We provide worlwide bulk sms services at a reasonable price with quality network .
The quickest and most convenient way to get free software with Low prices of BULK SMS.We will also provide a HTTP interface for the end user using which they can use HTTP URL deliver the messages.Please look forward for our coverage map, visit our website http://www.routesms.com.
We provide different Interfaces given below to send these sms with 24X7 Techincal support
1] Desktop Application which you can send sms directly
2] DLL which you can integrate in your software to send sms .
3]HTTP URL Link which can integrate into your website to send sms.
4] SMPP.
Kindly come online on : MSN id: asma.shaikh@routesms.com for further discussions, clarifications and testing of our services.Yahoo id: asma_routesms@yahoo.com, Skype id: asma_routesms.
No setup fees.
No monthly fees.
No license fees.
No maintenance.
No training required.
Only pay per SMS.
If people think it is an advertising message and do not receive such message again, please click Remove My email id from your list
Regards,
Asma Shaikh
Marketing Manager
---------------------------------
RouteSms Solutions Limited
Office No. 401, 4th Floor, Evershine Mall, Mind Space,New Link Road, Malad (W),Mumbai - 400 064, India
Office: +91 022-40337676/77/78/79/80-99 ext. 619
Mobile no: 91-9870299121
Fax no: +91-22-40337650
Email: asma.shaikh@routesms.com
web: www.routesms.com
MSN Chat Id: asma.shaikh@routesms.com, Yahoo Chat Id: asma_routesms@yahoo.com Skype : asma_routesms
Thanks a ton Bobby! You have no idea how much this was annoying the hell outta me... :D
Oh yea..just checked..it does not get saved..I saved it as Importantt' ..strange but yah must be of privacy reasons.
Hi Ammir
How are you
best of luck for your film \"Tare Zammen Par\"
we maharashrariyan pepople loves you ammir
Hi Aamir,
my fav actorof bollywood
WLL U REPLY?
Hey dude this is fantastic stuff! :-)
I found a website, for where you can send message to india for free.
http://www.indyarocks.com
This is dhruv from Florida.With Diwali around the corner back home,i have been busy scouting for bargains on indian calling cards.i found that reliance calling cards are offering the best value for money,since they have slashed their calling rates to as low as 5.9 cents/min and also offering 120 mins free talk time as an addon.Guess mom won\'t complain now that i never have time to talk to her!
amir khan is very good actor..but last 3 years he becomes best... i can say king of king..or \"OSCAR KING\" real start gives to india for bollywood film nomones to oscar we have to give all credit to aamirs .....
\"I M WAITING FOR GhAJINI \"
if you got a mac book you can do it by
-lode up safari
- clack on safari
-and reset safari
-then ok
and its dun
Hi,
Thanks a lot .. I was looking for this information for a long time
Hi Amir khan i am very happy to that i have to get chance for post my comments and viewes to u. First i salute u for your work to our nation.I have very inspired from u.
if \"iva\" uses Help so much, I wonder why she/he is reading this.
pls tell me how to details a phone outgong & incoming
Tare Zameen Par was cool, but I don\\\'t know if it was \\\'inspired\\\' by some western movie. I kind of loath that.
I think Amir is an intellectual and quick witted person, but I don\\\'t understand why things have gone so wrong in his family.
Watching TZP I could make out one thing, there was some personal touch to that, remember Amir is a college drop out and his brother is also struggling.
she has blue green eyes.not brown eyes.and her english is nice,which most educated indians do have.and indian race has both light skinned and dark skinned people.she is light skinned.if u dont knw much abt india and aishwarya,plz dont comment bad about sumone.
sins come back on you - said in all religions. ACCEPT THE FACT,THAT SHE IS THE MOST BEAUTIFUL LADY EVER
I love you my love more than love too death ... mobile :00965661499354
I am a Chinese, and will go to New Delhi in Feb 2009. Would any friend of yours be kind enough to show me the cost of how to buy a mobile number, and what will be the cost per min calling with mobile from India to china?
Send me Email and thank you very much in advance.
Aamir i rally appreciate u for the type of physic u have developed . it has now encouraged me to so that i can be at least be appreciated by others. thanks aamir . u r truly a person of great potential.
Hiiii..... Amir r u really rockstar i watched ur ghajni flim..
I got a missed mobile call yesterday from India. Could you advise the best method to trace back the details of the telephone number where the call originated? Call back on my mobile wouldn\'t allow the call to proceed.
Thanks
Regards
Kanwal
Namaste Aamir..........my self akshay stu of class10th..........
........after seen Gajini my aim is to be made a GAJINI part 2....
hiiiiiiiiii amir its nice to see ur movie ,u r one of the best actor & my favuorite actor !!!!!!!!
Hiiiiiiiiii amir
recently your toal films r superior, ur acting perfaction is so good. i saw gajani wonderfulllllllllllll acting.
I luv ur 2007 ride,juz wanna know if u can sell me ur 1992 camry by d side.
Local Delivery of Abhayapuri (Dist - Bongaigaon, Assam) very good for Flowing couriers - BlueDart, MiniCourier, Flight Desk Patch, First Flight, Cyber Express, Jyoti, Skylark Express, Inland, Dolphin, Trackon Etc.
dear sir/madam: i just want to know fully details of this mobile numbers: 9997907938. it\'s a dehradun mobile no. but i want to know adress full details. please send me it\'s argent. Thanx.
Thanks alot! I was trying to figure that out for my job project.
letest number
Guyz...
Check this out...the latest one
http://mobilecodes.blogspot.com/
Regards
Funky
Plz help me with 9645005***
u r so beautiful................
sudo cp destination-dir target-dir -r
Go to safari, click preferences, click autofill, UNclick the boxes, and Bobs your uncle!
latest version IV has same issue, I suspect it could be windows issue.
It\'s a good bargain. I\'m yet to see this one in India unless I completely missed out on it.
Hi
I can\'t 100% Agree the comments from these guys. I am doing business with spaceforhost for last 5 yrs.All are complaining regarding data loss in spaceforhost server. Sometimes it happen But as a serious customer we should atleast maintain our website backup.
But for customer support it is true , The customer support team is not thechnically sound. And in sundays tre is no online customer support and nobody will take phone.
Rgds
sreejith Nair
I have been trying to reduce size of desktop icons for last two days, until I found your site and your help was great. Thank you
I have an LG Rumor phone from Sprint that my daughter is giving me and I want to change to AT&T but I can\'t get the IMEI code. She has already transfered her service to AT&T so her Sprint account is closed and when I type in *#06# on the keyboard I get nothing. Any ideas?
Assalamo Alikum brother thank you very for this.
hi amir i like to with u please reply me.
Well the same thing I had trouble with and then suddenly the light came on ..Its so easy
Open google and go to prefernces and check the area you do not want to save search information the click on save preferences ...works every time. will also work in fire fox
Great post. But I would like to say I have been really disappointed with Enterprise lately. While I applaud their green efforts, I will not use their abuse of taxpayer money by playing victim for bailouts. The Wall Street Journal did a expose. You can read about it here:
http://digg.com/d1l2xh
You have to pay to get the full Wall Street Journal article.
pls try browsing http://coai.in/docs/ and look for file MSC Codes Jan09.xls...it is up-to-date...I tracked a twerp who used to disturb with blank calls...
Jogi
Helo bobby
after a long time.. please write to me . I want one of domain and do something nice...like latest pics uploading from imphal.
this is my blog
www.manipur2009.blogspot.com
niran
It\'s quite delicious you should try at a restaurant for not too ridiculous of a price.
Exactly what I needed! Thanks!
hi all i one person is distrubing me since 1 month can you tell me wat the method to trace such number
the person number is 9623871761
found out - indiatrace.com - take a look.. Very similar..to help trace mobile numbers location on india plus many more traces like vehicle... http://www.indiatrace.com checked out and found Reliance GSM info also ..quiet updated..
My experience with Blue Dart was horriable!
I got my ATM Pin no after 30 days .. and thats too after banging with these people(both end) for a week. They dont give a damn shit ..all they care is about thier business...
Whatever, i feel all the Courier services are the same when it comes to north eastern states..
Some of theme even dont have a center ..
Dear and Respected Amir Khan ji,
Namaste !
I want to write you. Please send me your correspondence address on my email address :- ms.jaipur76@gmail.com. I hope whatever I write to you, you will read and consider.
Thanking you with Regards,
Mahendra Singh
280, Saraswati Bhawan,
Prem Nagar, Gandhi Nagar,
Abu Road - 307026 (Rajasthan)
Phone - 9460714382
try http://www.indiatrace.com - free mobile number search location site to trace mobile number in india
Anyone know a good coupon from enterprise.com?
Truly appreciated, i have been trying to find this out for ever.
Thanks from Sweden
A new website to send Free SMS to INDIA , SMS INDIA.
sms india
daddy. . . is the best. . . .aamir hussain khan. . .iam in indonesia daddy. .i love you daddy aamir . . .by maulam yusuf
I tried that but on my version of IW which is 7.0.5730.13 that option doesn\'t work. I went back and typed in the first letter of any number of characters... a, b, g etc. Several suggestions followed. One thing I will try is closing the window and rebooting. Maybe that will help but if not then ideas need to be updted here with more current information as I followed going through previous suggestions and in MY version of IE there is no option to clear forms in the way suggested.
hello sir amir khan how are you? my brother like you so much ........he is your big fan.
I NEED YOUR HELP SIR
kindly please sir contact me .......i shall be very thankful to you .
i will wait for your reply....
(YA ALI MADAN)
thanks
fatima
THANK YOU.
It's been driving me crazy, the default icon size in VISTA takes up to much desktop real estate. Thank you for the solution.
i want the name of the person & detailed address of the mobile no. 9820808598 please help me
i dont un comment
Wow...I am so glad I googled this. Thanks for the tip. I spent 2 hours trying to find the feature in Excel. Will use keyboard tips in the future.
I was able to fix the problem.
I had the same problem after removing Windows Live Mail.
For some reasons, I could not get the .eml files to open with Outlook Express.
I followed the steps in the Microsoft article KB 312355 to run the Msimn executable file with the / reg option.
Make sure that when you click on START, then RUN and you type
"msimn / reg" make sure you leave a space after the word msimn and the / and also a space before you type reg.
This will open Outlook Express.
Second step, go to My computer, Folder Options, etc.... and in the registered files type, select EML click change, you will now select a new Outlook Express icon - and the problem will be fixed.
Good luck guys
Visit this site ti find mobile number location and circle
Trace Mobile Phone number location operator circle in India
Owned by me but nothing done yet (evil plan in the making)
http://huirem.com
http://nongmaithem.com
http://sekmai.com
And from a friend of mine
http://chabungbam.com/
Brajeshwar - Thanks for the info :). I will add these domain names to the list.
nice car. i have one 2. share your experience so far with me.
Please try to download some software like AVSVideo converter or OJOSoft video converter.
Hey Mr.Amir Khan,
I m die hard fan of you.You as an actor is fantabulous.But as a human being you also fantabulous. ur acting perfaction is so good. i saw gajani wonderfulllllllllllll acting.I m watching ur movies frm my child hood.....I think u creats ur own expectations n critarea....You look dam gud in 8 pack abs......Plz suggest me how can i got these abs n consentration which u have..............Plz tell Gud bye n take care......
Nimish Bhardwaj
Thanx buddy ..it was really helpful
Hi daer amir aejaz from mumbai here how ARE you what about your next movie?????? please contact me
As per the comments above I\'d tried and failed many times to reduce the icon sizes and accepted that it was an unchangeable constant not unlike the new Office Ribbon feature which is classed as an \'improvement\'.
Thanks for the advice on icon sizing. If you figure out a crafty way of replacing the ribbon with a classic mode I\'d be grateful...and so would the rest of my office!!
Dan
Hey i Love Your Car and it looks More nice and i Think your car is one of the Good Once But just take some advise give it a good and nice rims
Thanks a lot, it came as first result of google :). Thanks a lot again!!!!!!!!
I was supposed receive my consignment which include pan card on 4th july 09 but I have not received it. When I tracked the consignment it showed pending due to insufficient address . I don\\\'t know how it happened ,I have been receiving letters/documents at this address since 5 yrs.
First flight service is really worst. I am fear if I use this service in future.
My consignment no. ZB1926425
is there any site to get name of the person . pls do the needful.send me to my email id
Many information about sending sms
Visit this site to find mobile number location and circle
Trace Mobile Phone number location operator circle in India
http://csharpdotnetfreak.blogspot.com/2009/04/trace-mobile-location-operator-number.html
there is series of all india airtel\'s numbers
salaam,
sir ji
very good morning,i would like too work with u if think i can work with, your the super hero from my view you r super star of this bollywwod you r intelgent person in this indutries, n a good produces n actor of this india bolywood sir if u give me a chance to work under your guideance i would like to work in front or behind the sceren as u like .....
i give details of my self
name vikram singh
age 32yrs
phone no 9699526024
i would love 2 work with u if u give chance 2 work with .......thanking u vikrammmmmm
Thanks a million, you\'re a lifesaver!
Instead of manually identifying the mobile code on COAI excel sheet, why dont u try \\\"Visual Mobile Number Locator\\\" in www.ezrecharge.in.
And it supposed to be based on COAI\\\'s MSC codes only.
thanks
wasted one hour in excel help doc
Thank you so much for this tip!
Thank you for the post. It helped me out.
Thanks you!
it\'s the same thing in win7, ctrl key and mouse\'s wheelto reduce icons.
Hello Aamir this my first post in your blog so i think you have approved this comments. your acting is natural in your all the movie
Your a legend! thx
On a mac you need to hold down the apple key and press option then press enter.
www.thabal.com
I LOVE YOU!!!! Thanks
Complete list is also available at following link
http://www.itact2000.com/frmContent.aspx?MenuId=3
Just what I was looking for. Thanks!
Jake H.
Thank you! This has made my life much sunnier.
Can you imagine just how many people have been helped by this such a simple and single explanation. Not every one replies with a Thank you post. Wonder if Microsoft\'s complex minds would someday provide answers in such a straight way instead of going through 7 or 8 wizzard steps.
Thanks for the info. However it sounds like at the end of this you would need to pay Melbourne IT $35 a year to retain the domain name, versus $15 to Microsoft. Am I missing something? Is it not possible to simply tell a new hosting provider the domain name and registration key? (And then pay their annual renewal fee, if any.)
Bruce,
Good question. I did exactly what you mentioned in your comments. I transferred my domain name from MelbourneIT to GoDaddy, where it costs $8 to $9 per year.
Instructions on how to transfer the domain name from MelbourneIT to GoDaddy is available via the following links:
- http://help.godaddy.com/topic/160/article/1592?prog_id=GoDaddy&isc=gdbb2
- http://products.secureserver.net/products/domain_transfers/transfer_domain_melbourne_it_reseller.pdf
Note: The Domain Registration Key (DRK) provided initially is different from the Domain Name password required later during domain name transfer. MelbourneIT calls it Domain Name Password/authinfo (see step 19 below) while GoDaddy calls it an Authorization Code.
Thanks,
Bobby
Micro$oft help was pretty useless (online and offline). Wth Bobby, 4 years down the line your blog is STILL helpin folks! Now THAT\'S a good reason for keeping the internet free
First flight courier fool courier. I sent DEEPAWALI\'S GIFT.
through first flight on 14-oct-2009 from INDORE(m.p) to
BHOPAL(m.p). they told that courier will NOT deliver because
the address mentioned the gift box
is RONG ADDRESS
I called all offices/call center of first flight but
they are very irresponsible.everybody was telling oposite party pls collect the box.because its too many rush.
this courier is BAKWASSSSSSSSSSSSSSSSSSS.........courier SERVICE.
Thanks, this is a very helpful tip.
The link you have given is not working (http://www.relianceinfo.com/webapp/Infocomm/jsp/nochange/YourNewNumber.jsp.
Please could you email me with the correct link.
Thank You.
You Missed the latest videos,audio,cummunity,news website www.ManipurTV.com
I also want to share my bad experience from First flight couriers. I had ordered something from ebay.com and the seller had shipped the item on same day. Next day itself it arraived in bangalore and the web tracking status was showing as \'HOUSE LOCKED\'. But, the whole day my wife was avaialble in house and when i asked at the security gate, they told that nobody came from First Flight couriers. Nobody was picking the call at the customer care desk when i called(for 2 days) and finally someone answered at a branch in bangalore and told that it would be in some other branch. But there again , the land line was SWITCHED OFF. I wonder what do these people do at this pathetic organisation? People dont pick call, delivery man never calls and dont even come to address and says \'HOUSE LOCKED\'. dEAR FRIEDS....Avoid this horrible and terrible service....in fact no service...They call themselves international.... Even local courier services do better job....
WOHOO!!
Thank ye so much!
I need to appreciate the work done.... this is helping me a lot...
Hello,
I am trying to trace the details for the number 9538021791. Could anybody please help me?
Any help will be greatly appreciated!!
Thank you
Bang on the target!
Saved my day!
Thank You!
these are some of the domains i\'ve come across...
URL (Registration Date)
http://designspebam.com (2007-07-05)
http://pebam.info (2009-03-21)
http://isiroy.com (2008-11-27)
http://siroy.info (2008-10-29)
http://thokchom.com (2007-08-27)
http://devakishor.com (2008-10-15)
http://paochelkangleipak.net (2009-03-07)
tapta.com (2005-08-08)
easterndark.com (2009-08-23)
Check Out www.vivaconnect.in its pretty useful in sending free as well as paid sms to all networks including reliance..
i need to trace a cell no. vodafone mumbai .... can anyone help me
My hero!
One of teh worst courier service in hyderabd. first they dont know how to answer a phone call, 2nd : they answer the calls but dont speak, 3rd they disconnect the lines. i tried reaching the number : 040-32561070 reg to a Cargo delivery and this is the response that i receive. wonder in what shape would the goods be coming in.
CERTAINLY WOULDNT RECOMMEND THIS COURIER SERVICE TO ANYONE
Hi Aamir......
I love you. I like your all the movies. One of them Dil Chahta Hain is my favourite movie. I like your acting, dancing , different different hair style and specially your look in Ghajani.
I m fida on your smile. I will wait for your reply... so plz
thanks for your information .the stuff really works
Hi Aamir....
I regularly visit your site becoz I like to know more & more about you. I would like to know about your life style. Aamir... you have dashing personality.You know..my biggest dream is to meet you once in life. So you can only fulfill my this dream. Plz...I will wait for your reply.
Hi Aamir....
I regularly visit your site becoz I like to know more & more about you. I would like to know about your life style. Aamir... you have dashing personality.You know..my biggest dream is to meet you once in life. So you can only fulfill my this dream. Plz...I will wait for your reply.
You can try this cool website
http://www.indiaonapage.com/mobilenumbertrace
It works for even 8 series mobile numbers.. You can track latest mobile and landline numbers here..
Really cool website..
Thanks so much. I\'m using a Mac (and fairly new to it) and couldn\'t figure it out for the life of me!
woowwwww.........thank yoooo
it is great, I have been looking and asking how to do it...yoo cool dude
thanks very much guys, it was very annoying!!!
Thanks for the info. I have been with officelive for several years now and have not been happy. I have lost the ability to access my accounts several times, each reaching up to three weeks per incident with TERRIBLE customer support. I had even offered them money to fix the issues at one point and was refused unless I wanted to sign up for additional services.
I want to transfer my domain from officelive to Godaddy and take back control of our domain. Your article mentioned that once the account is cancelled, all data will be lost. Since I have multiple employees email accounts associated with officelive, and their emails a vital part of our business, is there a way to save all of the emails for each account somewhere locally before the cancellation so that we can retain the past years worth of emails?
Thanks again.
i changed it to classic
still i am not able to reduce the size of the icon
I think now focus should be on the solution.Can someone provide the details what sort of action can be taken against these offenders.I believe consumer court may be one option.
Man Oh Man...
You know, there is Microsoft (with their online help blabla) and there is you (one line is worth more than ... whatever!!! you know what I mean)...
THANK YOU MAN
Nothing works, may we have new links?
hello aamir ji
am die hard fan of urs..since childhood i admire u..cos u look so cute when i was child..n now in short U ROCKKKKKKKKKKKKKK. i was looikn forward U vth Kareena.. n now even dt has come true..am so exited about ur movie 3 idiots..i wud like to talk to u personaly...if u have at least 10 mins time pls reply to my mail id...shravanti.chowdary@gmail.com
keep going...
love u
shravanti
This is the best info that I found on THIS SUBJECT. To those who cannot access the \"Clear Search History\" link on your Google search drop-down box, this is a solution that worked for me. I, too, could not access the link because my search history was so long.
In the search box, I typed in ONE letter and waited for \"suggested searches\" to pop up. That is usually a short list, and at the bottom of the suggested list is the \"Clear Search History\" link. Voila! Hope it works for you as it did for me.
THAT was so easy..Thnk you.......BUT !!! I have other problems now.....I downloaded the updates for Vista as per Microsoft...and WOW everything grew so big.......I run Vista the first edition and was never told it was the BETA version !! what a mess I paid $3,600 for a heap of garbage.....HP Pavillion 7000..it crashed the second day.........and has been a problem ever since from hinge breaking to corner of the facia snapping off......and continual crashing.....HP said nothing they can do its the Beta version...???now this........if it crashes we are supposed to go into the start menu and hit RECOVERY...Ha !!!! thats ok if you can get into the start menu.......ohh well
I would so appreciate it if you could help me get everything else back to normal size.......with your wonderful help I have reduced the size of the icons ....but task bar and everything else is extra large........have tried every means know so far to reduce things down........nothing works....
PLEASE HELP ME.....and you\'ll have a friend for life....
www.FaceMaza.com is a place to create and share fun.
Make fun with faces like indian film celebrities, bollywood, kollywood actors & actress, Indian cricket players & sports celebrities, and with other comics super heros like Batman, He-man, Shrek, Teletubbies, Mickey mouse.
You can download customized images to PC, send to your friends, post/embed in social network sites like Orkut, Facebook etc.,
Using FaceMaza.com, you can…
1) Create and send facecards featuring your face in happy occasions like Christmas, New year and other seasonal festivals
2) Create and send facecards featuring your face in film stars/celebrities outfits
3) Get photograph with bride/bridegroom outfits
4) Get photograph with Indian traditional dance/art like Bharatanatyam, Kathakali etc.,
5) Put your face in WWF stars with six-pack body
6) Put you face in cute cartoon / comics character’s body
Create, share and delight your friends and family using www.FaceMaza.com
Dear Mr AAmir Khan,
I am srinath from Hyderabad working with Axis Bank Ltd as Manager , I want small help from you , i request you to please call me over my mobile 09849664193 , talking to you over the phone is my Life\'s dream , pls call me once , i will be more happy .
I hope you will call me once........
N Srinath, Manager , Axis Bank Ltd
Regional Team , Secunderabad
Hyderabad.
ALL IS WELL
Leonard,you are a genius.Why are the most simple solutions the most difficult to find? The answer is so obvious when you know and you really wonder why you didn\'t think of it yourself,thanks.
IS THERE ANY CHANCE TO KNOW THE DETAILS OF THE MOBILE NO. I AM TRYING TO TRACE THE DETAILS OF THIS NO.: 9491962092. BUT I AM NOT ABLE TO KNOW THE DETAILS. CAN U PROVIDE THE DETAILS OF THE BELOW NO.OTHER ALTERNATE NO.'S R WHO IS THAT PERSON WHICH PLACE ETC.....
Great job done...
You blog is 5 years old and still very helpful.
Thanks.
Thanks bob. That helps a lot.
Wow,. This is a time saver for me! :D
if i found you in front of me AMIR i will kill you sorry to say
this the full film in 3 idiots i have cried so much i have a
chest pain now and i have already seen the movie more then 30
times now you are too good Amir i am at your age only that's why i
am calling you Amir but now i love to call you Amir Sir you are
the best love you while sending you this comments i am still
crying i can stop doing that what kind of feeling i am having
after seen your so much of BALATKAR bhagwan kare aap ka ghar
STAAN SE BHAR DE aap ko kabhi bhi STAAN KI KAMI NA HO baki aap se
bada BALATKARI koi nahi hai meri najar main love you buddy best
wishes for your new BALATKAR
hi aamir, ilike u very much .recentaly the whole world had watched ur super movie 3 idiot really u r great .actually sir i want to meet u but i do not know how? SIR AGAR BY CHANCE BHOOLEY BHATKE MERE IS COMENT PAR NAZAR PAD JAYE TO MAI AAPKO KEreal script dena chati hu aur mujhe yakeen hai ki usko aap aisa innovative tarike se laoge ki log dekhte reh jayenge afterall u r perfectionist .hai na par shayad aisa na ho kyunki aap se milna ya aap tak pahuchna waise hi hai jaise subhah uthkar ishwar se baat karna ki wo hai aur meri baat sunega shayad aap bhi sun lo ..........hope for the best god is great
dear aamir. my cell no is 9415126266
www.manipurtv.com is awesome
Great help. Thanks Bob.
hiiiiiiiiiii aamir
hiiiiiiiiii
aamir i am your fan to convers you
i cant delete my drop down google search done every thing youve suggested but still doesnt wont delete help i have a son i dont want him to see
Thank you so much for sharing how to reduce the desktop icons. I as well spend hours, days trying to reduce the size of the icons, they were driviing me nuts.
Thank you! The computer techs at Office Depot did not know how to reduce the size of the icons. Glad I found your blog!
I think this SMS to Reliance mobile phones. - Bobby Maisnam -- Blog got really sweet things.
I mostly love this one www.jokesmsquote.com
Thanks, this worked for me…but in a roundabout way…I was just ggetting 500 errors on my modules page,when it wouldn’t load.
I got couple of sms from a number which starts from 80111
Do you guys have any idea about the number?
hiii aamir
this is vinay bhatia from shimla, i am ur big fan and i want to share something with you, i have a movie script based on the real issues suffered by youngsters like us . this script is basically based on casteism,love,passion. i know that you would definately like it. sir seriously i need your support. contact me at 09736224792
You da man, cheers Bob!
Thanks Bob!
Just what I needed! Cheers man.
Dear sir Aamir Khan i have seen all of your films and iam the assistant director in dramas in a production house i loved you very much but after watching 3 idiots i liks and respect your spirit in movies and your expression are very strog which is requore in the movies and theatres do more efforts like these.
haha lol.
Thanks from me too :)_
Thanks, you are the man!!
it was exactly what i wanted. thank u very much
Thankzzz
Thank you so much for the tip!
Tried both Ctrl+Enter and Shift+Enter but not Alt+Enter. :0
www.manipurtv.com is fantastic and i kinda loving to it by watching videos, songs and looking at pics.. and i really thanks to the owner of ManipurTV.com I hope more interesting sites coming up soon
I added a lot of software recently and was starting to get annoyed by the clutter. Thanks!!
5 years later and it\'s still a sweet tip!
i have best story/script for you
kindly contact me 9223190416
9892615132
Sweet, works like a charm. Keep it up bobby!
hi amir many many happy returns of the days...... all th citizens of india are really previlaged to have a wonderful actor like u among overselfs..............
I tried everything except alt+enter. :(
pl tell me how to know the new number in place of old number 93 series
\"Largest Collection of manipuri sms,manipur Proverbs on Internet and funny sms jokes for you to text message on your cellphone.\"
WOW! gr8. It works.
I thought about downloading some software for this purpose but thank god came across this blog.
Thanks
hey nice post,i tried sending sms on cdma network but no messages are sent,and can you tell me how can i send sms from yahoo messenger on TATA and RELIANCE numbers because whenever i send sms on these no. msg is displayed that \"messages cannot be sent on this number or number is incorrect\"
And thanks for this information.
You can check complete details on this link
Thanks dude!
I had a basic HP inkjet printer but the ink always seemed to dry up before I could use the whole cartridge. And I have often felt the need to scan or print something at home. I don\'t think I will be using the fax option that much though.
Nice tutorial man.
It was driving me nuts.
Thanks, you are God-sent.
SMS to reliance mobile phones through shared short code is introduced by a US Company Txtimpact. It allow to send sms from web or pc to all cellular networks using 5 or 6 digit short code. This shortcode is easy to remember and also your customer easily send sms to your server with request of products of features. see also http://www.txtimpact.com/shared-shortcode.asp
DNS tools have a few free tools to check if your mail server is blacklisted.Network and Free DNS tools. Check smtp mail server blacklists, run port scans, Trace route, NS Lookup, Dig, MX test, CNAME lookup, port scan,Online DNS Tools,Open Port Scan,Free DNS Software.collection of free DNS tools for troubleshooting, testing, checking.
http://www.dnsright.com/
Thank you! I tried Shift and Ctrl and Enter and Alt, but not alt+enter.
you rock!! thankyou! I\'ve never tried alt, only shift.
Life saver!
Thanks :)
It crashes the ego when we all think that we know a lot in Excel. Even after 5 years of this post, this comes as the first thing when googled. Though I had only came across such a need today, your blog helped me not to spend too much time to figure it out. Great....Thanks a ton....
Hello Sir,
This is Md Naushad Alam from NEPAL but right now im in Bangalore for my higher education, Actually sir this is my first time so if u will get any mistake then forgive me, by the way im crazy about your mind and ur decision, the way of ur taking decision really i get surprise. By the way when i see ur movie then one thing i must get that u have very much passion and u are the one of the best person in the world who makes crazy to the audience by giving wonderful job in the movie............
actually i always wait for ur new movie and i get diffent knowlegde and different passion from ur movie and by the way \'sir\' i want to be in contact with you because ur my ideal person and i learnt many things from ur life by reading ur biography and i got many things changed in my life by following u.....so please sir its my request that please reply me. if u will reply then nothing will change in ur life but Obviously i will get many changes by watching ur message that my idol person replied me a message.....actually i will be very happy and there will be no bound of my happiness...thank u.......
by the way my email id:-(naushadalam.passion4sse68@gmail.com)
Thank YOU! been trying to figure it out for months!
hi amir khan i like u and ur movies so ur best pics is big hair of mangal pande movie buy buy khuda hafiz ......?
Thank you thank you thank you thank you!!!!
Thanks Dude
First Flight couriers have the worst delivery than any of the couriers that i have ever experienced. If anybody misses one shipment the task to locate that is a very big one....even in a city like mumbai......Customer Service sucks...half the phone numbers are bunk and other half are always in switched off or busy....and when you manage to get one cc exec he / she is compleletly lost.....
This is why hummankind created the World Wide Web. Excel Help was useless but Bobby Maisnam is a deep hero (and a hat tip to the other Andy with the Macintosh tip). Now we can go back to our creative lives and love.
Thanks! You helped out a marketing dept in Lake Forest, CA!
You go dude.
I sent the courier throgh first flight on 28th of september to pune ( Symbiosis) to send my registration form for PGDHRDM and the last date for registration is on 30th of september. The guy told me that it will reach at pine on 30th september in morning, so I came online to check the status of my courier that it has been succesfully reached or not, but the website of first flight is very confusing and dnt know where to chcek the status and when I called the customer service department then they do not have answer. Now god knows my courier will reach there in time or I will be left for addmision till next year. Please its my humble request to the managment tem that improve your services. Couriers are to deliver the things in time and there is no use of couriers to send if things are not deivered in time!!!!!!!!
I am still having problems with DTMF & Skype - do you think these are related to sound card issues eg introducing distortion?
Thanks Dude
For Open office users ...
In Open Office Org Calc,
Ctrl+Enter : to enter new line in a cell
:)
Cheers..
The first flight courier is the worst courier service i have ever seen in my life. No timely delivery, no updated status. even nobody will receive the call if you try to contact them. Better choose ordinary post over it.
Thanks for this!
Awesome! Still useful more than 5 years after posting.
Just googled this and you're answer came straight up. Awesome, Thankyou!
ok wow u guys are soooooo jealous.....as for the picture with her \"brown\" eyes, it was from a movie where she had to wear brown contacts!!! Before making an arguement, u might have to check sources. Where does it possibly say that she got plastic surgery? Did u look it up? Did u find sources?? That\'s kind of like me saying that every single cheerleader in america is slut (totally made up). Indians have an accent, duh! So does EVERY SINGLE NON-AMERICAN!!! It\'s not like she was born here! Stop being haters!!! She was a Miss World....the judges knew what they were doing....so stop pretending u know every single thing about her....losers
thanx
I\'ve been looking about manipur in google and I found e-pao.net on top, follow by maniputv.com in second, kanglaonline.com. in third. Is there any website for telephone numbers for manipur
@meitei: Good point meitei. e-pao and kanglaonline are definitely the top websites about Manipur. However, please note that this list is based on when the domain names for the websites were first registered and not the popularity/google ranking of the websites.
Regarding your question about telephone numbers for manipur, I know www.meyamgi.com was a good resource but looks like the original owner did not renew the domain name and instead there is a placeholder page now.
- Bobby
Hello guys
cp -a source-dir target-dir
Thank you, thank you, thank you. Have been looking for a solution to very large icons on the desktop and then, disappearing icons on the desktop for ove two months...
Thanks for the tip it just saved my job lol.
i am using reliance gsm prepaid mobile. Whenever i go for setup my mobile No. for yahoo messenger then i get reply that,We are unable to support the number that you have provided at this time why?
Bloody amazing. This has been a bug for me for many years. Good on Google. Many thanks
Hey thanks for the shoutout! We are glad you like us. We hope we can continue to be the service provider you use to make your international calls.
Autumn
I am selling the bird nest primary products
It from Malaysia and Indonesia
These product is before going thru and chemical wash
It is purely organic
Interested please contact me
Thanks for the tip. Keep up the good work.
2011 and it still exist, but gmail now says \"Sorry, you can\'t create a label named \"important\" (it\'s a reserved system label). Please try another name:\"
Thanks, have been looking all over.
Can you please help me track my cellphone with my IMEI number?
My IMEI number: 358027035482976
The sequence has the "*" missing: It should be "*#06#".
Thanks for adding the Mac instruction. Been looking for this everywhere!!!
Hallelujah! A thousand thanks!
From 'Down Under' : love ya
Aamir, You - a brilliant actor!
Thanks lot bobby, from 2005 onwards still your post looking very young...long way to go....cheersup
if she is not intelligent and beautiful why she is chosen as miss world? you think the judges are stupid to choose someone who is fake? if you find her dumb then the judges who selected her in the event were also dumb. I found her to be smart and witty in the interview.she is just happy and excited.i would admit there is some of cultural gap between the two and others who seem not to know what is the reality outside their world.for me it is a very interesting, intellectual and humorous conversation and of course we need brains and good sense of humour to interpret it in a positive manner.
Excellent!!! it definitely made my day.
thanks Bobby
thank you so much for sharing this very helpful info. it really helped me since i just had a reboot on my laptop and icons returned big over my desktop. thank you again for the wonderful tips.
Thank you so much! :D
Hi aamir Bhai!
I am from pakistan. and want to talk to you on phone. plz give me number. if you cannot then here is my number. 0992346-5682959 Only one minute call can be the finest moment for me.
Regards
Aamir Shahzad
Pakistan
Thanks much Bobby!
I first learned how to do this years ago, but hadn't had a chance to use it so I promptly forgot. Thanks for refreshing my memory.
On March 3, 2011, I purchased the LivingSocial Fandango deal for two movie tickets posted by Bobby Maisnam. The only thing I ever received was a thank you email telling me that within 48 hours I would receive an email from the LivingSocial Team with a Promo Code and redemption instructions. I did NOT receive the Promo code or redemption instructions. How do I get what is needed to have the two tickets I paid for.
Marcella
Hi Marcella,
Looks like you bought the deal on time i.e. before they expired.
- Did you look at your "my deals" page after logging in to your LivingSocial account? Mine shows up there. You can click on "view promo code" to get the Fandango code.
- You can also click on the following link (https://livingsocial.com/fandango_promo_code) after logging into your LivingSocial account.
If you still have problems, please contact LivingSocial directly (https://help.livingsocial.com/ > Request Support). I am just another user :|
- Bobby
In order to get your promo code for the fandango movie tickets you purchased at the living social app. You must log in to the original living social website, not the mobile app. version and log in into ur account. Look for your purchases. Click on the fandango purchase and it will give you the promo code. It will tell you to enter your e-mail address and it will send you a confirmation receipt. Hope you\'re able to redeem your tickets, enjoy.