The longest domain name in the world
I came across this post on Dr. Karuturi's website and I realized that I had never thought about it. Domain names can be a maximum of 63 characters long without the top level extension i.e. .com, .org. co.uk etc.
So, the longest domain names in the world (for .com names) are:
[1] http://www.thelongestdomainnameintheworldandthensomeandthensomemoreandmore.com/ (67 characters = 63 characters + 4 characters for .com)
Note: Read it as "www dot the longest domain name in the world and then some and then some more and more dot com."
[2] http://www.iamtheproudownerofthelongestlongestlongestdomainnameinthisworld.com/ (67 characters = 63 characters + 4 characters for .com)
Note: Dr. Karuturi's new domain name. Read it as "www dot I am the proud owner of the longest longest longest domain name in this world dot com."
[3] http://3.141592653589793238462643383279502884197169399375105820974944592.com/ (67 characters = 63 characters + 4 characters for .com)
Note: The name is the first 65 characters of the value of Pi to one million decimal places.
[4] http://www.abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com/ (67 characters = 63 characters + 4 characters for .com)
Note: The site also offers free email. Of course, I did not sign up! :)
There can be many more which are this long. I will add them to this list as I find them.
Also, the longest single word domain name in the world is http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/ (64 characters = 58 characters + 6 characters for .co.uk)
It is the name of an actual village on the island of Anglesey in Wales, UK and the name itself is a Welsh word which translates as "St Mary's Church in the Hollow of the White Hazel near a Rapid Whirlpool and the Church of St. Tysilio near the Red Cave." For day-to-day purposes, the name is abbreviated to Llanfair PG or Llanfairpwll :).
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu is the name of a village in New Zealand. And at 92 characters, it is the longest placename in the World (according to the Guinness Book of World Records).
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
is the name of a village in Thailand and is 163 characters long. However it is not included in the Guinness book. (p.s. The word is so long that it was messing up the layout of my page. So, I broke it into 3 lines :). )
And of course, Pneumonoultramicroscopicsilicovolcanokoniosis is the longest English word (45 characters) and is defined as "a lung disease caused by the inhalation of very fine silica dust, mostly found in volcanos". It is also known as "p45" and is the longest word ever to appear in a non-technical dictionary of English (Oxford English Dictionary). The actual name of the disease is pneumoconiosis.

Very interesting, especially pi upto 1 million decimal places.
Hai bobby,
Now I am also the owner of Longest Domain Name in this world. Add this to you list
http://www.iamtheproudownerofthelongestlongestlongestdomainnameinthisworld.com
Well what about this then :
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochuchaf.org.uk/
This is a total of 70 characters including the org.uk. Longer than anything else. It's also a valid place name.
Hi Bobby,
I am Guru - heard a lot about you from Pushkar, Damu and Mama (Nitin Tiwari). Reached hear from your Orkut profile. Interesting trivia you got here on domain names.
BTW,
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
is not just a village in Thailand, it is the fully qualified Thai name for Bangkok city. As per Lonely Planet, it means "The city of angels, the great city, the eternal jewel city, the impregnable city of God Indra, the grand capital of the world endowed with nine precious gems, the happy city, abounding in an enormous Royal Palace that resembles the heavenly abode where reigns the reincarnated god, a city given by Indra and built by Vishnukarn (Vishwakarma - builder for the Hindu Gods)."
The name was so trippy that a local rock band made a song outta it. They just kept chanting the name again and again throughout the song!
Cheers,
Guru.