Today is July 4th, the American Independence Day. Went for a barbeque cookout at a friend’s place. Rain was predicted in the morning but when we finally reached there, the weather was great – not too hot and with a light breeze. The barbeque cookout was fun, the food was great and met a lot of nice people.
At night, me and my friends went to Knoxville World Fair Park to see the July 4th fireworks. We reached at 9 pm but the fireworks started a bit late – at about 9:45 pm. It was great and there were lots and lots of people. I did not have a camera with me but I took a couple of pictures with my camera phone. They came out ok, but not that great. Am putting one here.
Overall, the day was great and I really enjoyed it.
Note: July 4th is the day when the Declaration of Independence was signed and adopted in 1776, declaring independence from the British. If you would like to know more about the Fourth of July, please see this link.
Bobby
The first .com domain name
The first .com domain name was symbolics.com. It was registered on March 15 1985, more than 20 years back!
The first domain name to be registered was nordu.net which was registered on January 01 1985.
A list of the first 100 .com domain names is available here | cached copy.
I have also compiled a list of the domain names of the major tech and media companies to see which ones were registered when. IBM.com seems to be the first one in the list (March 19, 1986). Interestingly, both Adobe.com and AMD.com were registered on the same day (17 Nov, 1986).
ibm.com 1986-03-19
intel.com 1986-03-25
att.com 1986-04-25
adobe.com 1986-11-17
amd.com 1986-11-17
cisco.com 1987-05-14
dell.com 1988-11-22
oracle.com 1988-12-02
sony.com 1989-07-07
bbc.com 1989-07-15
microsoft.com 1991-05-02
infosys.com 1992-07-17
macromedia.com 1993-05-13
cnn.com 1993-09-22
timewarner.com 1994-04-28
amazon.com 1994-11-01
yahoo.com 1995-01-18
aol.com 1995-06-22
ebay.com 1995-08-04
google.com 1997-09-15
Batman Begins
Watched “Batman Begins” today. It was awesome!!! The movie is about how Bruce Wayne becomes Batman and how he saves Gotham city. Liam Neeson is also in the movie. And Katie Holmes plays Batman’s childhood friend and love interest later on.
The main Batman movies are:
[1] Batman (1989) starring Michael Keaton
[2] Batman Returns (1992) starring Michael Keaton
[3] Batman Forever (1995) starring Val Kilmer
[4] Batman and Robin (1997) starring George Clooney
[5] Batman Begins (2005) starring Christian Bale
I have watched all of them except [1].
Unlike the Star Wars movies, “Batman Begins” is not a prequel of the other movies (which I had originally assumed). It is whole new series starting afresh. So, we can expect more Batman movies in the future. And heard that another Batman movie with the Joker (Jack Nicholson played the Joker in the 1989 Batman) is coming up soon.
If you have read a couple of Batman comics and you love action movies, go see this movie. You will definitely love it!
The movie was released in the US on June 15, 2 days earlier than the worldwide release.
Another movie I am eagerly looking forward to is “War of the Worlds” which is releasing on June 29.
Related Links:
– Yahoo Movies
– CNN Review
– IMDB
– Official Site
– Wikipedia
CNN offers free video
Starting yesterday (June 18), CNN now offers free news video on its website. This is two days ahead of the original launch date, which was supposed to be June 20. Previously, it used to charge $4.95/month for access to news videos. The videos are supported by 15-second commercials. Also, if you go to CNN.com now, you will notice that the logo now has the phrase “With Free Video”.
www.cnn.com/video
This is a welcome step. I had always wanted to watch news videos on CNN. I know that BBC has always offered free news videos. I checked out a couple of the videos. They are of fairly good quality but occasionally, the video seemed to be a bit jumpy. This might be due to the heavy load of users trying to check out the new free video feature on the website.
Related Links:
6/18/2005: CNN.com debuts free video
5/16/2005: CNN.com to Make Its Online Video Free (Yahoo News/AP)
5/16/2005: CNN.com to offer free video, new premium service
The longest domain name in the world
I came across this post on Dr. Karuturi’s website and I realized that I had never thought about it. Domain names can be a maximum of 63 characters long without the top level extension i.e. .com, .org. co.uk etc.
So, the longest domain names in the world (for .com names) are:
[1] http://www.thelongestdomainnameintheworldandthensomeandthensomemoreandmore.com/ (67 characters = 63 characters + 4 characters for .com)
Note: Read it as “www dot the longest domain name in the world and then some and then some more and more dot com.”
[2] http://www.iamtheproudownerofthelongestlongestlongestdomainnameinthisworld.com/ (67 characters = 63 characters + 4 characters for .com)
Note: Dr. Karuturi’s new domain name. Read it as “www dot I am the proud owner of the longest longest longest domain name in this world dot com.”
[3] http://3.141592653589793238462643383279502884197169399375105820974944592.com/ (67 characters = 63 characters + 4 characters for .com)
Note: The name is the first 65 characters of the value of Pi to one million decimal places.
[4] http://www.abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com/ (67 characters = 63 characters + 4 characters for .com)
Note: The site also offers free email. Of course, I did not sign up! 🙂
There can be many more which are this long. I will add them to this list as I find them.
Also, the longest single word domain name in the world is http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/ (64 characters = 58 characters + 6 characters for .co.uk)
It is the name of an actual village on the island of Anglesey in Wales, UK and the name itself is a Welsh word which translates as “St Mary’s Church in the Hollow of the White Hazel near a Rapid Whirlpool and the Church of St. Tysilio near the Red Cave.” For day-to-day purposes, the name is abbreviated to Llanfair PG or Llanfairpwll :).
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu is the name of a village in New Zealand. And at 92 characters, it is the longest placename in the World (according to the Guinness Book of World Records).
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
is the name of a village in Thailand and is 163 characters long. However it is not included in the Guinness book. (p.s. The word is so long that it was messing up the layout of my page. So, I broke it into 3 lines :). )
And of course, Pneumonoultramicroscopicsilicovolcanokoniosis is the longest English word (45 characters) and is defined as “a lung disease caused by the inhalation of very fine silica dust, mostly found in volcanos”. It is also known as “p45” and is the longest word ever to appear in a non-technical dictionary of English (Oxford English Dictionary). The actual name of the disease is pneumoconiosis.
AOL/AIM Mail – 2 GB with IMAP access
AOL/AIM is now offering free email. I signed up for one yesterday. If you already have an AIM username, you can access your webmail at http://mail.aol.com/.
And today, I found out that it also provides IMAP access. I tested the IMAP connection with Outlook Express and it works nicely. The settings are:
IMAP server: imap.aol.com
Port: 143 (default port)
As far as I know, no other email service – Gmail, Yahoo, Rediffmail and even Yahoo Mail Plus do not offer IMAP access. I think Outlook Express can be configured to access Hotmail but I am not sure if it is POP or IMAP, or whether it works for all free accounts.
btw, Fastmail does offer free IMAP access but provides only 10 MB storage space.
I will test AOL/AIM mail for some more time and I will post my experiences here.
Related Links:
– 06/06/2005: AOL Launches Free Email Service (CNN Money)
– 05/05/2005: Yahoo now offers 1 GB email space
– 11/16/2004: Gmail POP access
Bobo’s first birthday
Today is my nephew Bobo’s first birthday.
Happy Birthday Bobo!!!
Related post:
– 5/21/2004: Became an uncle today!
Star Wars: Episode III – Revenge of the Sith
Watched “Star Wars: Episode III – Revenge of the Sith” today. It was awesome!
The movie is about how Anakin Skywalker turned to the Dark Side of the Force to become Darth Vader. It was released yesterday at 12 am! CNN reports that the movie grossed a record $50 million in the first 24 hours, the highest box office tally for a single day.
I always thought that the Star Wars movies were in the reverse order. But today, I looked at Wikipedia and found that the order of the movies is 4,5,6,1,2,3. Well, if you consider 4-6 as one block and 1-3 as the other, then it can be said that the movies were released in reverse order: 4-6,1-3.
The films in the Star Wars series are:
1. Star Wars Episode I: The Phantom Menace (19 May 1999)
2. Star Wars Episode II: Attack of the Clones (16 May 2002)
3. Star Wars Episode III: Revenge of the Sith (19 May 2005)
4. Star Wars Episode IV: A New Hope (25 May 1977) (originally titled Star Wars)
5. Star Wars Episode V: The Empire Strikes Back (21 May 1980)
6. Star Wars Episode VI: Return of the Jedi (25 May 1983)
I have watched all 6 except the original Star Wars (1997).
I am also looking forward to watching “Mr. and Mrs. Smith” (releasing June 10, 2005) and “Batman Begins” (releasing June 15, 2005).
Related Links:
– Star Wars (Wikipedia)
– Closing the circle of ‘Star Wars’ (CNN)
– Official website
– Yahoo Movies
– IMDB
Rediffmail autologin shell script
Rediffmail has a 30 day login policy. This means that, if a user does not login at least once over a period of 30 days, email delivery to the account is stopped. Also, if the user does not login over a period of 45 days, all existing emails are deleted. I have access to 5 or 6 rediffmail accounts and I frequently use only 1 or 2 of these. I got the 30-day warning in 2 of my accounts sometime back. Since then, I have made it a point to login to all my accounts at least once in two weeks. This was very inconvenient for me and so I decided to write a script to auto-login into my rediffmail email accounts so that I do not lose my emails due to the 30/45 day login policy.
Download code (3 kb zipped file)
Note: To use this script, you need to have shell access to a Unix/Linux machine.
[1] File 1: login.sh (the shell script)
lynx -dump -post_data http://mail.rediff.com/cgi-bin/login.cgi < /home/maisnam/cron/rediff/myemail1.txt
lynx -dump -post_data http://mail.rediff.com/cgi-bin/login.cgi < /home/maisnam/cron/rediff/myemail2.txt
lynx -dump -post_data http://mail.rediff.com/cgi-bin/login.cgi < /home/maisnam/cron/rediff/myemail3.txt
[2a] File 2a: myemail1.txt
FormName=existing&login=myemail1&passwd=mypassword1
[2b] File 2b: myemail2.txt
FormName=existing&login=myemail2&passwd=mypassword2
[2c] File 2c: myemail3.txt
FormName=existing&login=myemail3&passwd=mypassword3
In the above example, I have 3 email accounts - myemail1@rediffmail.com, myemail2@rediffmail.com and myemail3@rediffmail.com. Their username and password information is stored in 3 files: myemail1.txt, myemail2.txt and myemail3.txt. The shell script reads in the information from each file and passes them to the login script as a POST entry. The output (which is currently pushed to /dev/null) would be the text-only(lynx) view of the inbox screen for each email account.
[3] Add to crontab
The shell script in [1] has to be executed periodically by adding an entry to the crontab file. An example crontab entry would look like this:
0 0 * * 2,4,6 sh /home/maisnam/cron/rediff/login.sh > /dev/null 2>&1
In the above case, the script would be executed at 12 am, 3 times every week on Tuesday, Thursday and Saturday.
A sample file structure is available here.
The code (zipped file) is available here (3 kb).
Useful Links:
– http://www.adminschoice.com/docs/crontab.htm
– http://www.rt.com/man/lynx.1.html
– http://lists.debian.org/debian-devel/1999/08/msg01594.html
Finding new 93 number for old Reliance number
Some people have been emailing me regarding how to the find the new 93 numbers for old 011-3119-1234 style Reliance numbers. You can find the new 93 number by going to this URL:
http://www.relianceinfo.com/webapp/Infocomm/jsp/nochange/YourNewNumber.jsp
Related Links:
– All About 93
– 93 FAQ’s
– Mar 9, 2004: SMS to Reliance mobile phones